KEGG   Bacillus cereus biovar anthracis CI: BACI_c43570Help
Entry
BACI_c43570       CDS       T01279                                 

Definition
aldehyde-alcohol dehydrogenase
Orthology
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    BACI_c43570
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BACI_c43570
   00620 Pyruvate metabolism
    BACI_c43570
   00650 Butanoate metabolism
    BACI_c43570
  Lipid metabolism
   00071 Fatty acid degradation
    BACI_c43570
  Amino acid metabolism
   00350 Tyrosine metabolism
    BACI_c43570
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    BACI_c43570
   00626 Naphthalene degradation
    BACI_c43570
Enzymes [BR:bal01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     BACI_c43570
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     BACI_c43570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4108148..4110751)
Genome map
AA seq 867 aa AA seqDB search
MVVKEKVVNEMQEVKEMIDMLVNNGRKALQALESFTQEQIDNIVHEMVLAGVDQHMPLAK
LAVEETGRGVYEDKCIKNIFATEYIWHSIKKDKTVGIIHEDPHEEIIEIAEPVGVVAGVT
PVTNPTSTTMFKALIAIKTRNPIIFAFHPSAQKCSIAAAKTVYDAAVKAGAPEHCIQWIE
KPSVEATKQLMNHEGVALVLATGGAGMVKSAYSTGKPALGVGPGNVPCYIEKSAHIKRAV
NDLILSKTFDNGMICASEQAIIVDKEIYDDVKTEMITNDCYFVTEEERRKLEKLVINENT
CAVNSDIVGKCAQYIAELVGITVPKNTKMLVAEIQGIGAAYPLSREKLSPVLACVKANSL
EEGFTYCEEMLNLGGLGHSAVIHSVNKEVQKQFGLRMKACRLIVNAPSSQGGIGDIYNGF
IPSLTLGCGSYGKNSVSQNVTATHLLNIKRLANRKKNMQWFKLPPKIYFEKHATAYLANM
PNISRAFIVTDPGMVEHGYVDTVAHYLRKHANDVKVEVFFEVEPDPSDETVFKGAEMMRS
FQPDVIIALGGGSAMDAAKGMWLFYEYPETTFYGIKQKFLDIRKRTCKYPKLGSKAQFVA
IPTTSGTGSEVTPFAVITDKKNNIKYPLADYELTPDVAIVDPQFVMTVPPHVTADTGMDV
LTHAIEAYVSVLANDYTDGLALKAIDLVFKYLPRAFKDGHDEEAREKMHNASAIAGMAFA
NAFLGINHSLAHKIGPEFHIPHGCANAILMPHVIRYNAIKPRKHALFPKYEHFVADERYA
HIARMLGLPASSVAEGVESLVKAIIDLGKSLNINMSIAGQGVAKDQFEEVVGLLAERAFE
DQCTTANPKLPLISELKEIYMKAYKGE
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggtagtcaaagagaaagttgtaaatgaaatgcaggaagtaaaagagatgattgatatg
ttagtgaataacggtcggaaggctttacaagcattagaaagttttacacaagagcaaatt
gacaacattgttcatgaaatggtattagcaggtgttgatcaacatatgcctcttgcgaag
ttggctgttgaagaaacaggtcgtggtgtatacgaagataaatgcattaaaaatattttt
gctactgaatatatttggcatagcataaagaaagataaaacagtagggattattcacgaa
gaccctcatgaagaaataatagaaattgcggagcccgtcggtgtagtagctggggtaact
ccagtaacgaatccaacatcgacaacaatgtttaaagcattaatcgcgataaaaacgaga
aatccaattattttcgcatttcatccttcagcacaaaaatgttctattgcagccgcgaaa
acagtatacgatgcagcggtgaaggcgggtgcaccagaacattgtattcagtggattgaa
aaaccttctgtcgaagcaacgaaacaattaatgaaccatgaaggtgttgcgcttgttttg
gcaactggaggggctggtatggtgaaatcagcttattctactggaaaaccagcgctaggt
gtaggtcctggtaatgtaccatgttatatagagaaatcagcgcatataaaaagagcggtt
aatgatttgattttatcaaaaacgtttgataacgggatgatttgtgcatcagaacaagca
atcattgtagacaaggaaatttatgatgatgtgaaaacagaaatgattacaaatgattgt
tactttgtaacagaggaagagagaagaaaattagaaaagcttgttattaatgaaaataca
tgtgcagtaaatagtgatattgtagggaaatgtgcacagtatattgccgaattagttgga
attactgtacctaaaaatacaaaaatgcttgtagctgaaatacaaggcatcggagccgca
tatccactatctcgtgagaagttaagtccagtattagcttgtgtaaaagcaaattcatta
gaagaaggatttacatattgtgaagaaatgttaaacctcggtggcttagggcattcagca
gttatccattctgtaaataaagaagtgcaaaagcaatttggattacgtatgaaagcttgc
cgccttattgtaaatgctccttcatcacaaggtggaatcggtgacatatataatggattt
attccatcacttacgcttggctgcggttcctacgggaaaaactcggtttctcaaaacgta
acagcgacgcacttattaaatataaaaaggttggcaaatagaaaaaagaatatgcagtgg
ttcaaattaccaccaaaaatttattttgaaaaacatgcgacagcatatttagcaaatatg
cctaacatttcacgtgcgtttattgtaacggatccaggaatggttgagcatggatatgta
gatacggtcgcgcattatttacgtaaacatgcaaatgatgtgaaagtagaagttttcttt
gaggttgagccagatccatcagatgaaacggtttttaaaggtgcggaaatgatgagaagt
tttcagcctgatgtcatcatcgcacttggtggtggttcagcgatggatgcagcgaaaggg
atgtggcttttctatgagtacccagaaacaacattctatggaattaaacagaagttttta
gatataagaaaacgtacatgtaaatatccgaaattaggaagtaaggcgcagtttgttgct
attccaacaacatctggaacaggatcagaagtgacaccatttgcggttattacagataag
aaaaataatataaagtatccactcgcggattatgaattaacgccagatgtagcaattgtt
gatccgcaatttgtaatgacagtaccaccacatgtaacagcagatactgggatggacgta
ttaacgcatgcaatcgaggcatatgtgtctgttttagcaaatgattatacagatggatta
gcattaaaggccattgatctcgtatttaaatatttaccaagagcatttaaagatggacat
gatgaagaagcacgagaaaaaatgcataatgcttctgcaattgcagggatggcatttgca
aatgcattcctaggtattaatcacagtttagcacataaaattggaccagaattccatatt
ccgcatggatgtgcgaatgcaattcttatgccgcacgtaattcgttataatgctattaag
ccaagaaaacacgcattgttcccaaaatatgagcattttgtagctgatgaacgctatgca
catattgcgagaatgctcgggctaccagcaagttcggtggcagaaggtgtagaatcactc
gtcaaagcaattattgatctcggaaaaagtttaaatataaatatgagtattgcgggacaa
ggagttgctaaagaccaatttgaagaggttgttggattattagcagaaagagcttttgaa
gatcaatgtacaacagctaatccgaaattacctctcatttcagagctgaaagaaatttat
atgaaagcatataaaggtgagtaa

DBGET integrated database retrieval system