KEGG   Bacillus cereus biovar anthracis CI: BACI_c43800Help
Entry
BACI_c43800       CDS       T01279                                 

Definition
recombinase D
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:bal00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    BACI_c43800
Enzymes [BR:bal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     BACI_c43800
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4129812..4132148)
Genome map
AA seq 778 aa AA seqDB search
MGNQHAMDLFEEEKKFIKAQVLHTIFHNEENLYSVVSMKVIETNETYDEKKVMINGHFPR
MHEDEVFTLTGHFKDHPKYGKQYLVETFKKELPQTKAGMVQYLASDLFKGIGKRTAEKIV
DHLGEHAISKIMDDPEALNGVVNKQKAQEIYETIVEHQGLEKVMSFLNGYGFGTKLSIKI
YQQYKEMTLEVIRNNPYQLIEEVDGIGFGRADDIGRALGISGNHDDRVRAGCFYTLENVS
LQLGHVYMRKDQLIRETMSLLNNQEGRVTEEDIISCIEMMQSEGKVIIEEERVYLASLFY
SEKGVVKSIRRLMNQEETPSFPEAEVLKTLGEIEEQLNVQYAPLQQEAIQTALHKPMMLL
TGGPGTGKTTVIKGIVEMYASLHGLSLNPNEYSDDNPFPILLTAPTGRAAKRMSESTGLP
ACTIHRLLGWTPEGSFQRNETDPVQGKLLIIDEFSMVDIWLANQLFKSLPTNIQVIVVGD
EDQLPSVGPGQVLKDLLNAGAVPTVKLTEIYRQAEGSSVIQLAHAIKNGTLPPDLAQNQK
DRSFIGCTGAQIVEVVKKVCENAKTKGFSARDVQVLAPMYRGPAGINVLNEALQEVFNPK
REKSKEIAYGDVVYRRGDKVLQLVNQPESQVFNGDIGEIVSVFYAKENVEQQDMIIVSFD
GIEVTYTKPDLNQITHAYCCSIHKSQGSEFPIVIMPIVKSYNRMLRRNLIYTGITRSKKF
LIICGEEAAFQSGVNRLDDAMRQTTLASRLQESQGEVQMVTVNGEEMDVENISPYDFM
NT seq 2337 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatcaacatgcaatggatttgtttgaggaagagaaaaagtttataaaagcgcaa
gttcttcataccattttccacaacgaagaaaacctctattccgttgtcagtatgaaagtc
attgaaacgaatgaaacgtacgacgaaaaaaaagtgatgataaacggtcattttccccgc
atgcatgaagatgaagtgtttacgttgacaggacattttaaagaccatccgaagtatggg
aaacaatatttagttgaaacgtttaagaaagaattgccgcaaacaaaagcaggtatggtg
caatatttagcgagtgatttatttaaagggataggaaaacgtacagctgaaaaaattgtg
gaccatctaggggaacatgctatttctaaaattatggatgatcctgaggctttaaacggt
gttgttaacaaacaaaaagcgcaagaaatatatgagacaattgttgaacatcaaggatta
gagaaagtaatgagttttttaaatggttacggttttggaacgaagctttctattaagatt
tatcagcagtataaagagatgacattagaagtgattcgtaataacccatatcagcttatt
gaagaagtggatgggattggatttggaagagcggatgatatcggacgtgcgttaggtata
tcgggtaatcatgatgatcgtgtacgcgcgggatgtttttatacgttagagaatgtatca
ttacaacttggtcacgtttatatgagaaaagatcaacttataagagaaacgatgtcactt
ttaaataatcaagaaggaagagtgacagaggaagacattataagctgtattgaaatgatg
cagagtgaagggaaagtcatcatcgaagaagagcgagtatatttggcatcgttattctat
tctgaaaaaggtgttgtaaagtctattcgcaggctcatgaatcaggaagaaacaccttca
tttcctgaagcagaagtgttaaagacgttaggtgaaattgaagaacaattgaacgtacag
tatgcaccgcttcagcaagaagcaattcaaacggcacttcataagccgatgatgttattg
acaggtggaccaggaacaggaaaaacaacagttattaaaggaattgttgaaatgtatgcg
tcacttcacgggctatcgttaaatccgaatgaatatagtgatgataatccatttccgata
ctattaacagctccaacaggaagagcagcgaagcgaatgagtgaatcaacagggcttcca
gcttgcacaattcaccgtttacttggatggacgccagaagggtctttccagcgtaatgaa
acagatccggtacaagggaaattactcattattgatgaattttcaatggttgatatttgg
cttgcaaatcagctgtttaagtcattgccgactaacattcaagttatcgttgtaggggat
gaagatcaattaccatctgtaggacctgggcaagtattgaaagatttattgaatgcaggt
gcagttccaacagtaaagcttactgaaatttatcgtcaagcggaaggttcatcagtgatt
caacttgctcatgcgataaaaaatggaacgctcccaccagatttagcgcaaaatcaaaaa
gatcgttcatttatcggctgcacaggagctcaaattgttgaggttgttaagaaggtttgc
gaaaacgctaagacaaaagggtttagcgcaagagatgtacaagtattggccccgatgtat
cgtggaccggctggtattaatgtactaaacgaagcgttgcaagaagtgtttaatccgaaa
agagaaaagagtaaagaaattgcttacggtgatgttgtataccgaagaggcgataaagtt
ttgcaactcgttaatcagccggagagccaagtatttaatggtgatatcggcgaaattgtt
tcggtgttttatgcgaaagaaaacgttgagcaacaagatatgattatcgtttcatttgat
ggaattgaggtaacatatacaaaaccagatttaaatcaaattacacatgcttattgctgt
tccattcataaatcgcaaggtagtgagtttcccattgtgattatgccgatagtgaaaagt
tataatcgtatgttacgtcgtaatttaatttatactggtattacaagaagtaagaagttc
cttattatttgcggggaggaagctgcttttcagtctggtgtaaatcgccttgatgatgca
atgcgtcaaacgactttagctagccgcttgcaagaatcacaaggagaagtacagatggta
acggttaatggcgaagaaatggacgtggaaaacatttcaccgtatgatttcatgtaa

DBGET integrated database retrieval system