KEGG   Bacillus cereus biovar anthracis CI: BACI_c43890Help
Entry
BACI_c43890       CDS       T01279                                 

Gene name
aspS
Definition
aspartyl-tRNA synthetase
Orthology
K01876  
aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:bal00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4139628..4141403)
Genome map
AA seq 591 aa AA seqDB search
MAERTHACGKVTVEAVGQTVQLKGWVQKRRDLGGLIFIDLRDRTGIVQVVFNPETSKEAL
EVAETIRSEYVLHVEGTVVERGEGAINDNMATGRIEVQATKVNVLNAAKTTPIIIADDTD
ASEDVRLKYRYLDLRRPVMFNTFKMRHDVTKTIRNFLDTEEFLEVETPILTKSTPEGARD
YLVPSRVHDGEFYALPQSPQLFKQLLMVGGFERYYQVARCFRDEDLRADRQPEFTQIDIE
ASFLTQDEILDMMERMMTKVMKDAKGVEVSAPFPRMKYADAMARYGSDKPDTRFEMELTD
LSEFAAGCGFKVFTSAVESGGQVKAINAKGAASKYSRKDIDALTEFVKVYGAKGLAWLKV
EEDGLKGPIAKFFGEEDANVLMSTLEATAGDLLLFVADKKSVVADSLGALRLRLGKELEL
IDESKFNFLWVTDWPLLEYDEDADRYFAAHHPFTMPFREDVELLETAPEKARAQAYDLVL
NGYELGGGSLRIYERDVQEKMFKALGFSQEEAQEQFGFLLEAFEYGTPPHGGIALGLDRL
VMLLAGRTNLRDTIAFPKTASASCLLTEAPSPVAEAQLEELNLKLSLKEEK
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaaagaacacatgcatgtggaaaagtaacagtagaagcagttggacaaacagtt
caattaaaaggttgggtacaaaaacgccgtgatttaggtggattaatctttatcgactta
cgtgatcgtacaggtatcgtacaagttgtatttaacccagaaacatcaaaagaagcgcta
gaagtagcagaaacaattcgtagcgaatacgtattacacgtagaaggtacagttgttgag
cgtggtgaaggcgcaattaatgacaatatggcaacaggtcgtattgaagtacaagcaacg
aaagtaaacgtattaaatgcagcgaaaacaacgccaatcattattgctgatgatacagat
gcatcagaagatgtacgtttgaaatatcgttatttagacttacgtcgtcctgtaatgttt
aacacattcaaaatgcgtcacgacgtaacgaaaacaattcgtaacttcttagatacagaa
gagttcttagaagtggaaacaccaattttaacgaagagcacaccagaaggcgctcgtgac
tatttagtaccaagtcgtgtacatgacggtgaattctatgcattaccacagtctccacag
ctatttaaacagcttcttatggtcggtggatttgagcgttactatcaagtagcacgttgt
ttccgtgacgaagatttacgtgcggatcgtcaaccagaattcacgcaaatcgatatcgaa
gcttcattcttaacacaagatgaaattttagatatgatggagcgcatgatgacgaaagtt
atgaaggatgcaaaaggtgtagaagttagcgcaccattccctcgtatgaaatatgctgat
gcaatggctcgctacggctctgataagccagatacacgctttgaaatggaactaacagac
ttatctgagtttgcagcaggttgtgggtttaaagtatttacaagtgctgtagaaagcggc
ggacaagtaaaagcaattaatgcgaaaggtgctgcgagcaaatactctcgtaaagatatc
gatgcattaactgaattcgtaaaagtatacggtgcaaaaggtttagcttggcttaaagtg
gaagaagatggcttaaaaggaccaatcgcgaaattcttcggtgaagaagatgcgaacgtg
ttaatgagtacattagaagctactgctggtgacttattactattcgtagcagataagaag
agcgttgttgcagatagcttaggcgcacttcgtttgcgtctaggtaaagagcttgagtta
attgacgaaagtaaatttaacttcctatgggtaacggattggccacttcttgagtacgac
gaagatgcagatcgttacttcgcagctcaccacccattcacaatgcctttccgtgaagat
gttgagttattagaaacagcaccagaaaaagcacgtgcgcaagcatatgaccttgtatta
aacggttatgagcttggcggtggatcacttcgtatttacgagcgtgacgtacaagaaaaa
atgttcaaagcacttggattctcacaagaagaagcacaagagcaattcggattcttatta
gaagcattcgaatacggtacgccaccacacggcggtatcgcattagggttagaccgcctt
gttatgttacttgcaggacgtacgaaccttcgcgacacaattgcattcccgaaaacagca
agcgcaagctgcttattaacagaagctccaagcccagttgcagaagcacagcttgaagag
ttaaacttaaaattaagcttaaaagaagagaagtaa

DBGET integrated database retrieval system