KEGG   Bacillus cereus biovar anthracis CI: BACI_c43890Help
Entry
BACI_c43890       CDS       T01279                                 

Gene name
aspS
Definition
aspartyl-tRNA synthetase
Orthology
K01876  
aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Brite
KEGG Orthology (KO) [BR:bal00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    BACI_c43890 (aspS)
Enzymes [BR:bal01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     BACI_c43890 (aspS)
Amino acid related enzymes [BR:bal01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   BACI_c43890 (aspS)
Transfer RNA biogenesis [BR:bal03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    BACI_c43890 (aspS)
 Prokaryotic Type
   Other AARSs
    BACI_c43890 (aspS)
Mitochondrial biogenesis [BR:bal03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    BACI_c43890 (aspS)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4139628..4141403)
Genome map
AA seq 591 aa AA seqDB search
MAERTHACGKVTVEAVGQTVQLKGWVQKRRDLGGLIFIDLRDRTGIVQVVFNPETSKEAL
EVAETIRSEYVLHVEGTVVERGEGAINDNMATGRIEVQATKVNVLNAAKTTPIIIADDTD
ASEDVRLKYRYLDLRRPVMFNTFKMRHDVTKTIRNFLDTEEFLEVETPILTKSTPEGARD
YLVPSRVHDGEFYALPQSPQLFKQLLMVGGFERYYQVARCFRDEDLRADRQPEFTQIDIE
ASFLTQDEILDMMERMMTKVMKDAKGVEVSAPFPRMKYADAMARYGSDKPDTRFEMELTD
LSEFAAGCGFKVFTSAVESGGQVKAINAKGAASKYSRKDIDALTEFVKVYGAKGLAWLKV
EEDGLKGPIAKFFGEEDANVLMSTLEATAGDLLLFVADKKSVVADSLGALRLRLGKELEL
IDESKFNFLWVTDWPLLEYDEDADRYFAAHHPFTMPFREDVELLETAPEKARAQAYDLVL
NGYELGGGSLRIYERDVQEKMFKALGFSQEEAQEQFGFLLEAFEYGTPPHGGIALGLDRL
VMLLAGRTNLRDTIAFPKTASASCLLTEAPSPVAEAQLEELNLKLSLKEEK
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaaagaacacatgcatgtggaaaagtaacagtagaagcagttggacaaacagtt
caattaaaaggttgggtacaaaaacgccgtgatttaggtggattaatctttatcgactta
cgtgatcgtacaggtatcgtacaagttgtatttaacccagaaacatcaaaagaagcgcta
gaagtagcagaaacaattcgtagcgaatacgtattacacgtagaaggtacagttgttgag
cgtggtgaaggcgcaattaatgacaatatggcaacaggtcgtattgaagtacaagcaacg
aaagtaaacgtattaaatgcagcgaaaacaacgccaatcattattgctgatgatacagat
gcatcagaagatgtacgtttgaaatatcgttatttagacttacgtcgtcctgtaatgttt
aacacattcaaaatgcgtcacgacgtaacgaaaacaattcgtaacttcttagatacagaa
gagttcttagaagtggaaacaccaattttaacgaagagcacaccagaaggcgctcgtgac
tatttagtaccaagtcgtgtacatgacggtgaattctatgcattaccacagtctccacag
ctatttaaacagcttcttatggtcggtggatttgagcgttactatcaagtagcacgttgt
ttccgtgacgaagatttacgtgcggatcgtcaaccagaattcacgcaaatcgatatcgaa
gcttcattcttaacacaagatgaaattttagatatgatggagcgcatgatgacgaaagtt
atgaaggatgcaaaaggtgtagaagttagcgcaccattccctcgtatgaaatatgctgat
gcaatggctcgctacggctctgataagccagatacacgctttgaaatggaactaacagac
ttatctgagtttgcagcaggttgtgggtttaaagtatttacaagtgctgtagaaagcggc
ggacaagtaaaagcaattaatgcgaaaggtgctgcgagcaaatactctcgtaaagatatc
gatgcattaactgaattcgtaaaagtatacggtgcaaaaggtttagcttggcttaaagtg
gaagaagatggcttaaaaggaccaatcgcgaaattcttcggtgaagaagatgcgaacgtg
ttaatgagtacattagaagctactgctggtgacttattactattcgtagcagataagaag
agcgttgttgcagatagcttaggcgcacttcgtttgcgtctaggtaaagagcttgagtta
attgacgaaagtaaatttaacttcctatgggtaacggattggccacttcttgagtacgac
gaagatgcagatcgttacttcgcagctcaccacccattcacaatgcctttccgtgaagat
gttgagttattagaaacagcaccagaaaaagcacgtgcgcaagcatatgaccttgtatta
aacggttatgagcttggcggtggatcacttcgtatttacgagcgtgacgtacaagaaaaa
atgttcaaagcacttggattctcacaagaagaagcacaagagcaattcggattcttatta
gaagcattcgaatacggtacgccaccacacggcggtatcgcattagggttagaccgcctt
gttatgttacttgcaggacgtacgaaccttcgcgacacaattgcattcccgaaaacagca
agcgcaagctgcttattaacagaagctccaagcccagttgcagaagcacagcttgaagag
ttaaacttaaaattaagcttaaaagaagagaagtaa

DBGET integrated database retrieval system