KEGG   Bacillus cereus biovar anthracis CI: BACI_c45160Help
Entry
BACI_c45160       CDS       T01279                                 

Gene name
phaB2
Definition
enoyl-CoA hydratase
Orthology
K13767  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Fatty acid degradation
Metabolic pathways
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    BACI_c45160 (phaB2)
  Lipid metabolism
   00071 Fatty acid degradation
    BACI_c45160 (phaB2)
Enzymes [BR:bal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     BACI_c45160 (phaB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4262499..4263275)
Genome map
AA seq 258 aa AA seqDB search
MLKFLSVRVEDHIAVATLNHAPANAMSSQVMHDVTELIDQVEKDDNIRVVVIHGEGRFFS
AGADIKEFTSVTEAKQATELAQLGQVTFERVEKCSKPVIAAIHGAALGGGLEFAMSCHMR
FATESAKLGLPELTLGLIPGFAGTQRLPRYVGKAKACEMMLTSTPITGAEALKWGLVNGV
FAEETFLDDTLKVAKQIAGKSPATARAVLELLQTTKSSHYYEGVQREAQIFGEVFTSEDG
REGVAAFLEKRKPSFSGR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaattcctatctgtaagagttgaagatcatatcgcggtggctacgttaaatcat
gcgccagctaacgcgatgtcttcacaagttatgcatgacgttactgaattaattgatcaa
gtggagaaggatgataatattcgtgttgttgttattcatggtgaagggcgcttcttctcg
gcgggagcagatattaaagaatttacatctgttactgaagcgaagcaagcgactgaatta
gcgcagcttggacaagttacgtttgagcgcgttgaaaaatgttcaaaaccagttatcgcg
gcaattcatggagcggcacttggcggcggccttgagtttgctatgtcttgccacatgcgc
tttgcaactgaaagcgcaaaacttggtttacctgaattaacacttggattaattcctgga
tttgcaggtacacagcgattaccacgttatgttgggaaagcgaaagcttgtgaaatgatg
ttaacaagtacaccgattactggtgcagaagcattaaaatggggactagttaacggagtt
tttgctgaagaaacatttttagatgatacgcttaaagttgcaaaacagattgctggaaaa
agcccagcgacggcccgtgctgtactagagttattgcaaacgacgaaatcgtctcattat
tatgagggtgtacaacgcgaagctcaaatctttggtgaagtatttacgagtgaagatgga
agagaaggtgtagcagcatttttagaaaagcgtaagccttcatttagtggcaggtag

DBGET integrated database retrieval system