KEGG   Bacillus cereus biovar anthracis CI: BACI_c47520Help
Entry
BACI_c47520       CDS       T01279                                 

Definition
aspartate racemase
Orthology
K01779  
aspartate racemase [EC:5.1.1.13]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Alanine, aspartate and glutamate metabolism
Nonribosomal peptide structures
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bal00250]
Metabolism; Metabolism of terpenoids and polyketides; Nonribosomal peptide structures [PATH:bal01054]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4479762..4480436
Genome map
AA seq 224 aa AA seqDB search
MIGILAGMGPKSTGPFVDTVVAECQTIYGAKHDIDFPHMMIYSCPTPFYMDRPIDHEAMK
KAIIEGAQKLESTGASFIAMPCNTAHLYFEELQQSLSIPILNIVDETLKAIPETAKRVAL
LATEATVQAGIYQDGIAKRNIEYIHYEQWQESINQIITYIKSGEVEEARELWSALVLQLK
DEVDTAIIACTDLNVVASEDFVDSAQCLAKAVVRMYLSNTKRSS
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atgattggaatactagcaggaatggggccaaaatcaactggaccattcgttgatacagtt
gtagcagagtgccaaacaatatacggagcaaaacatgatatagactttcctcatatgatg
atttattcgtgcccaacaccgttttacatggatcgccccattgatcatgaagcgatgaaa
aaagcgattattgaaggggcacaaaaactcgagagtactggcgcaagctttatcgctatg
ccgtgcaatacagcgcatctttattttgaagaattacagcaatctctttctattcctatt
ttgaatatagttgatgaaacgttaaaagcgattcctgaaactgcaaaaagagtcgctctt
cttgcaacggaagcaactgttcaagctggtatttaccaagatgggattgcaaagcgtaat
atagagtacattcattacgaacaatggcaggaaagcattaatcaaattattacttatatt
aaatctggagaggttgaagaagctcgcgaattgtggagtgcgctcgttttacaattgaaa
gatgaagttgatactgcaattatcgcatgtactgatttgaatgtagtggcgagtgaggat
tttgttgattctgctcaatgtcttgcgaaagcggttgttaggatgtatctatcaaataca
aagagatcttcataa

DBGET integrated database retrieval system