KEGG   Bacillus cereus biovar anthracis CI: BACI_c47560Help
Entry
BACI_c47560       CDS       T01279                                 

Definition
alpha/beta hydrolase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    BACI_c47560
Enzymes [BR:bal01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     BACI_c47560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4483306..4484109)
Genome map
AA seq 267 aa AA seqDB search
MWNYEAEEAKAVIVIVHGAMEYHGRYEAVAEMWNHIGYHVVMGDLPSHGTTSRNRGHIDS
FDEYIEEVKLWVKEARKYRLPIFLFGHSMGGLIVIRMMQETKREDVDGIILSSPCLGVLA
GPSAPLQAASKILNVIAPKLQFATNLTVEMSTRNHEVRDAMENDSLFLRKVSVRWYSELI
KSIEIAHKKIDDFPDVPLLLMQACEDKLVDKTRVRTWFNNVKISDKAFKEWPNCYHELLN
EYERDEILNYIQSFTEIRINNIIETNK
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atgtggaattatgaagctgaagaagcaaaggctgtaatcgttatcgtgcacggcgcaatg
gaatatcacggacgctatgaagccgttgcggaaatgtggaatcatatcggctaccacgtc
gtgatgggggaccttccgtcacatggaacgacttcaagaaatagaggacatattgattcg
tttgatgaatacatagaggaagttaaattatgggtgaaagaggcaagaaagtatcggtta
cctatttttctatttggtcatagtatgggtggtcttattgtcattcgtatgatgcaagaa
acgaagagagaagatgtagacggcattattttaagttcgccatgtttaggtgtattagct
ggaccttctgcaccgcttcaagctgcctcaaaaatattaaatgttatcgctccgaagtta
caatttgcaacgaatcttacagtggaaatgtcaacgcgtaatcatgaagtgagagatgcg
atggagaacgattcattgttcttgcgcaaagtatcagtacgttggtatagtgaattgatt
aagtctattgaaatcgctcataaaaaaatagatgattttccagatgttccgctcttgcta
atgcaagcatgtgaggataaacttgtagataaaacacgtgtccgcacttggtttaataat
gttaaaataagtgataaggcttttaaagaatggccgaattgttatcatgagttattaaat
gagtatgagcgtgatgaaattttgaattatattcagtcatttactgaaatacgcatcaat
aacataatagaaacaaataagtaa

DBGET integrated database retrieval system