KEGG   Bacillus cereus biovar anthracis CI: BACI_c48600Help
Entry
BACI_c48600       CDS       T01279                                 

Definition
(GenBank) hydrolase; menaquinone biosynthesis related protein; possible prolyl aminopeptidase
  KO
K08680  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC:4.2.99.20]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
bal00130  Ubiquinone and other terpenoid-quinone biosynthesis
bal01100  Metabolic pathways
bal01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BACI_c48600
Enzymes [BR:bal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     BACI_c48600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Thioesterase Ndr DLH PGAP1 DUF676 DUF915 BAAT_C
Motif
Other DBs
NCBI-ProteinID: ADK07441
UniProt: D8H0H3
Position
complement(4577643..4578455)
Genome map
AA seq 270 aa AA seqDB search
MNVTLQGVSYEYEVVGSGEPLLLLHGFTGSMETWRSFVPSWSEQFQVILVDIVGHGKTES
PEDVTHYDIRNAALQMKELLDYLHIEKAHILGYSMGGRLAITMACLYPEYVRSLLLENCT
AGLEREDERKERCEKDERLADKIEREGIESFVSMWESIPLFETQKRLAQNVQEAVRKERL
ANNPKGLANSLRGMGTGAQPSWWNELKNLKMPVLLMNGEHDEKFFRILKNIEKCVSDAKF
VKIDGAGHAIHVEQPEKFDTIVKGFLKTMQ
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaacgctgcagggtgtatcgtatgaatatgaagtagtcggaagcggagaacca
cttctacttcttcatggttttacgggaagcatggaaacgtggcgttcattcgttccttct
tggagcgagcaatttcaagttattttagtagacattgttgggcacggaaaaacagaaagc
cctgaagatgtgacgcattatgatattcgaaatgcggcattgcaaatgaaagagctgcta
gattaccttcatattgaaaaagcgcacatacttggctattcaatgggcggtagactagcg
attacgatggcatgtctatatccggaatatgtacgttctcttttattagaaaattgtaca
gctgggcttgaaagggaagatgagcgaaaagaacgctgtgaaaaagatgagcgacttgcc
gataaaatcgagcgagaaggcatcgaaagttttgtatcgatgtgggaaagtattccgctg
tttgaaacgcaaaaacgtttagcacaaaacgtacaagaggcagtgcgaaaagaacgactt
gctaacaatccaaaagggctcgcaaatagcttgcgcggcatgggaacaggggctcagcct
tcatggtggaatgagctgaaaaacttaaaaatgcctgttcttttaatgaacggtgagcat
gatgaaaagttctttcgcatattaaaaaatatcgaaaaatgcgtctctgacgcgaaattt
gtcaaaattgatggtgctggtcatgcaattcatgtggaacaaccggaaaagtttgataca
atagtaaagggatttctaaaaactatgcagtga

DBGET integrated database retrieval system