KEGG   Bacillus cereus biovar anthracis CI: BACI_c48600Help
Entry
BACI_c48600       CDS       T01279                                 

Definition
hydrolase
Orthology
K08680  
2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC:4.2.99.20]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    BACI_c48600
Enzymes [BR:bal01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.20  2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
     BACI_c48600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4577643..4578455)
Genome map
AA seq 270 aa AA seqDB search
MNVTLQGVSYEYEVVGSGEPLLLLHGFTGSMETWRSFVPSWSEQFQVILVDIVGHGKTES
PEDVTHYDIRNAALQMKELLDYLHIEKAHILGYSMGGRLAITMACLYPEYVRSLLLENCT
AGLEREDERKERCEKDERLADKIEREGIESFVSMWESIPLFETQKRLAQNVQEAVRKERL
ANNPKGLANSLRGMGTGAQPSWWNELKNLKMPVLLMNGEHDEKFFRILKNIEKCVSDAKF
VKIDGAGHAIHVEQPEKFDTIVKGFLKTMQ
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaacgctgcagggtgtatcgtatgaatatgaagtagtcggaagcggagaacca
cttctacttcttcatggttttacgggaagcatggaaacgtggcgttcattcgttccttct
tggagcgagcaatttcaagttattttagtagacattgttgggcacggaaaaacagaaagc
cctgaagatgtgacgcattatgatattcgaaatgcggcattgcaaatgaaagagctgcta
gattaccttcatattgaaaaagcgcacatacttggctattcaatgggcggtagactagcg
attacgatggcatgtctatatccggaatatgtacgttctcttttattagaaaattgtaca
gctgggcttgaaagggaagatgagcgaaaagaacgctgtgaaaaagatgagcgacttgcc
gataaaatcgagcgagaaggcatcgaaagttttgtatcgatgtgggaaagtattccgctg
tttgaaacgcaaaaacgtttagcacaaaacgtacaagaggcagtgcgaaaagaacgactt
gctaacaatccaaaagggctcgcaaatagcttgcgcggcatgggaacaggggctcagcct
tcatggtggaatgagctgaaaaacttaaaaatgcctgttcttttaatgaacggtgagcat
gatgaaaagttctttcgcatattaaaaaatatcgaaaaatgcgtctctgacgcgaaattt
gtcaaaattgatggtgctggtcatgcaattcatgtggaacaaccggaaaagtttgataca
atagtaaagggatttctaaaaactatgcagtga

  All links  
No link information was found.   
DBGET integrated database retrieval system