KEGG   Bacillus cereus biovar anthracis CI: BACI_c48600Help
Entry
BACI_c48600       CDS       T01279                                 

Definition
hydrolase
Orthology
K08680  
2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC:4.2.99.20]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Ubiquinone and other terpenoid-quinone biosynthesis [PATH:bal00130]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4577643..4578455)
Genome map
AA seq 270 aa AA seqDB search
MNVTLQGVSYEYEVVGSGEPLLLLHGFTGSMETWRSFVPSWSEQFQVILVDIVGHGKTES
PEDVTHYDIRNAALQMKELLDYLHIEKAHILGYSMGGRLAITMACLYPEYVRSLLLENCT
AGLEREDERKERCEKDERLADKIEREGIESFVSMWESIPLFETQKRLAQNVQEAVRKERL
ANNPKGLANSLRGMGTGAQPSWWNELKNLKMPVLLMNGEHDEKFFRILKNIEKCVSDAKF
VKIDGAGHAIHVEQPEKFDTIVKGFLKTMQ
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgaacgtaacgctgcagggtgtatcgtatgaatatgaagtagtcggaagcggagaacca
cttctacttcttcatggttttacgggaagcatggaaacgtggcgttcattcgttccttct
tggagcgagcaatttcaagttattttagtagacattgttgggcacggaaaaacagaaagc
cctgaagatgtgacgcattatgatattcgaaatgcggcattgcaaatgaaagagctgcta
gattaccttcatattgaaaaagcgcacatacttggctattcaatgggcggtagactagcg
attacgatggcatgtctatatccggaatatgtacgttctcttttattagaaaattgtaca
gctgggcttgaaagggaagatgagcgaaaagaacgctgtgaaaaagatgagcgacttgcc
gataaaatcgagcgagaaggcatcgaaagttttgtatcgatgtgggaaagtattccgctg
tttgaaacgcaaaaacgtttagcacaaaacgtacaagaggcagtgcgaaaagaacgactt
gctaacaatccaaaagggctcgcaaatagcttgcgcggcatgggaacaggggctcagcct
tcatggtggaatgagctgaaaaacttaaaaatgcctgttcttttaatgaacggtgagcat
gatgaaaagttctttcgcatattaaaaaatatcgaaaaatgcgtctctgacgcgaaattt
gtcaaaattgatggtgctggtcatgcaattcatgtggaacaaccggaaaagtttgataca
atagtaaagggatttctaaaaactatgcagtga

DBGET integrated database retrieval system