KEGG   Bacillus cereus biovar anthracis CI: BACI_c48730Help
Entry
BACI_c48730       CDS       T01279                                 

Gene name
glgB
Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:bal00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4592274..4594211)
Genome map
AA seq 645 aa AA seqDB search
MSVINCEEVKRDEFHTEKYYESYNIFGAHIVTEDEMRGVRFTVWAPHAKAMSVVGDFNEW
DYEQHKMLQVTEEGIWSLFIPHIEEREIYKYAIETMAGDVIFKADPYAVYAEVRPNTASV
VFDIKGYEWNDKNWSRKKKKKSVYKEAMIVYELHFGSWKKKEDGTLYSYREMAEELIPYV
VEHQFTHIEIMPLVEHPYDRSWGYQGTGYYAATSRFGTPHDLMHFVDECHKYGIGVILDW
VPGHFCKDAHGLYLFDGTPTYEYKDKDVQENPVWGTVNFDLGKREVRNFLISNALFWMRY
FHIDGFRVDAVANMLYWNKEGQEQSNEHAVSFLRELNEAVFAEDEDFLMTAEDSTAWPLV
TAPTYEGGLGFNYKWNMGWMNDVLKYMECAPEYRKYIHDKMTFSLLYAYSENFILPLSHD
EVVHGKKSLLNKMPGDYWDKFAQLRLLYGYFFTHPGKKLLFMGGEFGQFDEWKDLEDLDW
NLHDFEMHRYMHDYFKELIALYKRSKPLWQLDHSREGFQWIDANNNEQSIFSFIRQGDKQ
EDALVVVCNFTKATYENYKVGVPDFEYYNEVLNSDAEQYGGSGQVNKKRLKTIQEPYHNQ
TAHVEITIPPFGVSILRPVKTRKGSKKQDGSKTKVRSNVTSRGKR
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
ttgagtgtaataaattgtgaagaagtgaaacgagatgagtttcataccgaaaagtactat
gaaagttataacatctttggcgcacatattgtgacggaagatgagatgcgaggtgtacga
tttacagtatgggctcctcatgcgaaagcaatgagtgttgttggagattttaatgaatgg
gattatgagcaacataagatgctgcaagtgacagaagagggaatttggtccctatttata
ccgcatatagaagaaagagaaatatataaatatgcgattgaaacgatggctggtgatgtc
atttttaaggcagatccgtatgctgtgtatgcagaagtaagaccgaatacggcatctgta
gtttttgatataaagggatatgaatggaatgataaaaactggagccgtaagaaaaagaaa
aaatcggtttataaagaagcgatgatagtttatgaattacatttcggttcttggaaaaag
aaagaagatggaacactgtattcttacagagaaatggcagaagaactcattccttatgtg
gtggaacatcaatttacacatattgaaattatgccgcttgttgagcatccatatgatcgt
tcttggggatatcaagggacgggatattatgcagcaacgagtagattcggcacgccacat
gatttgatgcattttgtcgatgaatgtcataaatatggaatcggtgtcattttagattgg
gtgccggggcatttttgtaaagatgctcacggtttatatttgtttgatgggacaccgact
tatgaatataaagataaagatgtgcaagaaaatccagtatggggaactgtcaactttgat
ttaggaaagagggaagtacgtaatttcttaatttcaaatgcgttattttggatgagatat
ttccatattgatggtttcagggtggatgcagttgcgaacatgctgtactggaataaagaa
ggacaagagcaaagtaatgagcacgctgtgtcatttttacgagagttaaatgaagcggtg
tttgcagaggatgaagattttcttatgacagcagaggattcaacagcttggccacttgta
acagctccaacatatgaaggtgggcttggattcaattacaaatggaatatgggctggatg
aatgacgtgctgaaatatatggaatgtgcgccagagtacagaaaatatattcatgataaa
atgacgttctctttactatatgcttactctgaaaatttcatattaccgctttctcatgat
gaagtcgttcatgggaaaaagtcgttattaaataaaatgccaggagactactgggataag
tttgctcaacttcgtttattatatggatatttctttactcacccaggaaagaaattactt
ttcatgggaggagaattcgggcagtttgatgagtggaaagaccttgaagatttagattgg
aatttacatgattttgaaatgcatcgttatatgcatgattactttaaagagctcatagca
ttgtataagcgctctaaaccactttggcagcttgatcattcgcgtgaaggatttcagtgg
attgatgctaataataatgagcaaagtattttctcttttatccgccaaggggataaacaa
gaagatgcgttagttgtcgtatgtaattttacgaaagctacatatgaaaactataaagta
ggtgtaccagatttcgagtattataacgaggttttaaacagtgatgctgagcaatatggc
ggatcagggcaagtaaataagaaacgtcttaagacgattcaagaaccgtatcataatcaa
acagcacatgtagaaattacaattccaccatttggcgtatccatattacgaccagtgaag
acgagaaaggggagcaaaaaacaagatggctcaaaaacaaaagtgcgtagcaatgttact
agcagggggaaaaggtag

DBGET integrated database retrieval system