KEGG   Bacillus cereus biovar anthracis CI: BACI_c49440Help
Entry
BACI_c49440       CDS       T01279                                 

Gene name
dapF
Definition
diaminopimelate epimerase
Orthology
K01778  
diaminopimelate epimerase [EC:5.1.1.7]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    BACI_c49440 (dapF)
  Amino acid metabolism
   00300 Lysine biosynthesis
    BACI_c49440 (dapF)
Enzymes [BR:bal01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.7  diaminopimelate epimerase
     BACI_c49440 (dapF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4651656..4652522)
Genome map
AA seq 288 aa AA seqDB search
MSQFSFTKMHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAP
VKMRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEDTVFAIETLAGIVTAEVTVEEGKVTL
AKIDMGAPRLTRAEIPMLGEGETPFIRENFLYNNHRYAFTAVSMGNPHAVIFVDDVEQAP
LTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGACAAVVASILN
GKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYKIEA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagccaattttcttttacaaaaatgcatggtcttggcaatagttatatatatgtaaat
atgtttgaagaacaaattcctgaagaagatttagctcttgtggcggaaaaggtttcaaat
attaatactggtattggagccgatggaatgattttaatttgtccatctgacgtagcacct
gtgaaaatgcgcatgtttaataatgatggatcagaaggaaagagctgtggtaacggtcta
cgctgcgtagcgaaatatgcgtatgagcataaactagtagaagatacagttttcgcaatt
gaaacgttagctggcattgtaacggcggaagtaacggtagaagaagggaaagttacgtta
gcgaaaatcgatatgggagcacctcgtttaacacgtgcggaaataccgatgcttggtgaa
ggtgaaaccccatttattcgtgaaaacttcttatacaataatcatcgttatgcatttaca
gctgtttcaatgggaaatccgcatgcggttatttttgtggatgatgtagaacaagcacct
cttacaacacttggaccagttcttgagacacatgaaatgttcccagaacgagtaaatgtt
gaatttatcgagattttgaatgaagaagagatgaacttccgcgtttgggaacgtggatct
ggcgtaacacaagcttgcggaacaggggcgtgtgctgcagttgttgcctctattttaaat
gggaagatggaacgtggtaaggaaattacagttcatttagctggcggcgatttaatgatt
gcatggacagaagaaggcaatgtgttaatgaaaggaccagcggaagtaatttgccgcgga
gtgtatgagtacaagatagaagcgtaa

DBGET integrated database retrieval system