KEGG   Bacillus cereus biovar anthracis CI: BACI_c49440Help
Entry
BACI_c49440       CDS       T01279                                 

Gene name
dapF
Definition
diaminopimelate epimerase
Orthology
K01778  
diaminopimelate epimerase [EC:5.1.1.7]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Lysine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Lysine biosynthesis, acetyl-DAP pathway, aspartate => lysine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bal01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:bal00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4651656..4652522)
Genome map
AA seq 288 aa AA seqDB search
MSQFSFTKMHGLGNSYIYVNMFEEQIPEEDLALVAEKVSNINTGIGADGMILICPSDVAP
VKMRMFNNDGSEGKSCGNGLRCVAKYAYEHKLVEDTVFAIETLAGIVTAEVTVEEGKVTL
AKIDMGAPRLTRAEIPMLGEGETPFIRENFLYNNHRYAFTAVSMGNPHAVIFVDDVEQAP
LTTLGPVLETHEMFPERVNVEFIEILNEEEMNFRVWERGSGVTQACGTGACAAVVASILN
GKMERGKEITVHLAGGDLMIAWTEEGNVLMKGPAEVICRGVYEYKIEA
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgagccaattttcttttacaaaaatgcatggtcttggcaatagttatatatatgtaaat
atgtttgaagaacaaattcctgaagaagatttagctcttgtggcggaaaaggtttcaaat
attaatactggtattggagccgatggaatgattttaatttgtccatctgacgtagcacct
gtgaaaatgcgcatgtttaataatgatggatcagaaggaaagagctgtggtaacggtcta
cgctgcgtagcgaaatatgcgtatgagcataaactagtagaagatacagttttcgcaatt
gaaacgttagctggcattgtaacggcggaagtaacggtagaagaagggaaagttacgtta
gcgaaaatcgatatgggagcacctcgtttaacacgtgcggaaataccgatgcttggtgaa
ggtgaaaccccatttattcgtgaaaacttcttatacaataatcatcgttatgcatttaca
gctgtttcaatgggaaatccgcatgcggttatttttgtggatgatgtagaacaagcacct
cttacaacacttggaccagttcttgagacacatgaaatgttcccagaacgagtaaatgtt
gaatttatcgagattttgaatgaagaagagatgaacttccgcgtttgggaacgtggatct
ggcgtaacacaagcttgcggaacaggggcgtgtgctgcagttgttgcctctattttaaat
gggaagatggaacgtggtaaggaaattacagttcatttagctggcggcgatttaatgatt
gcatggacagaagaaggcaatgtgttaatgaaaggaccagcggaagtaatttgccgcgga
gtgtatgagtacaagatagaagcgtaa

DBGET integrated database retrieval system