KEGG   Bacillus cereus biovar anthracis CI: BACI_c49760Help
Entry
BACI_c49760       CDS       T01279                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    BACI_c49760
   01230 Biosynthesis of amino acids
    BACI_c49760
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BACI_c49760
  Energy metabolism
   00680 Methane metabolism
    BACI_c49760
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BACI_c49760
Enzymes [BR:bal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BACI_c49760
Exosome [BR:bal04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BACI_c49760
  Exosomal proteins of melanoma cells
   BACI_c49760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4676677..4677231
Genome map
AA seq 184 aa AA seqDB search
MKKIIVIRHCSATGQERDAELTTDGKKQANTLATFLLEHHPQIDHIISSPFVRAIDSIRP
YARQANLSIQEDERLAERILSDVPMDDWMQKLESTFTNIDIAFSGGESTKQATDRAISLI
QHVLKLNYTTTLLVTHGNLLTLILKYFDHTIGFNEWRTLTNPDMYEITIDEQYALKRLWE
ASSK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattattgtcatacgacattgttcagcgactggccaagaacgtgatgccgaa
ttaacgaccgatggaaaaaaacaagcaaacacccttgctacattcctcttagagcaccat
ccacaaatagaccatattatttcaagcccatttgtgcgagctatcgattctattcggccc
tatgcacgccaagccaatttgtctatccaagaagatgaacgattagctgaacgcatatta
agcgacgttccaatggacgattggatgcaaaaactagaatctacttttacaaatatagat
attgccttttcaggcggggagtcaacgaaacaagcaacggatcgtgctatatcgcttatc
caacacgttttaaaattaaactatactacaacactacttgttacacatggcaatttactt
acactcattttaaagtactttgatcatacaatcggctttaatgaatggcgaactttaacg
aatcctgatatgtatgaaattacaatcgatgaacaatatgccctaaaacgattatgggaa
gcatcatccaagtaa

DBGET integrated database retrieval system