KEGG   Bacillus cereus biovar anthracis CI: BACI_c49760Help
Entry
BACI_c49760       CDS       T01279                                 

Definition
(GenBank) phosphoglycerate mutase family protein
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
bal00010  Glycolysis / Gluconeogenesis
bal00260  Glycine, serine and threonine metabolism
bal00680  Methane metabolism
bal01100  Metabolic pathways
bal01110  Biosynthesis of secondary metabolites
bal01120  Microbial metabolism in diverse environments
bal01130  Biosynthesis of antibiotics
bal01200  Carbon metabolism
bal01230  Biosynthesis of amino acids
Module
bal_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
bal_M00002  Glycolysis, core module involving three-carbon compounds
bal_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bal00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    BACI_c49760
  Energy metabolism
   00680 Methane metabolism
    BACI_c49760
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BACI_c49760
Enzymes [BR:bal01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     BACI_c49760
Membrane trafficking [BR:bal04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    BACI_c49760
Exosome [BR:bal04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   BACI_c49760
  Exosomal proteins of melanoma cells
   BACI_c49760
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1 DUF3402 Fer4_12 NusB
Motif
Other DBs
NCBI-ProteinID: ADK07531
UniProt: D8H1I0
Position
4676677..4677231
Genome map
AA seq 184 aa AA seqDB search
MKKIIVIRHCSATGQERDAELTTDGKKQANTLATFLLEHHPQIDHIISSPFVRAIDSIRP
YARQANLSIQEDERLAERILSDVPMDDWMQKLESTFTNIDIAFSGGESTKQATDRAISLI
QHVLKLNYTTTLLVTHGNLLTLILKYFDHTIGFNEWRTLTNPDMYEITIDEQYALKRLWE
ASSK
NT seq 555 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattattgtcatacgacattgttcagcgactggccaagaacgtgatgccgaa
ttaacgaccgatggaaaaaaacaagcaaacacccttgctacattcctcttagagcaccat
ccacaaatagaccatattatttcaagcccatttgtgcgagctatcgattctattcggccc
tatgcacgccaagccaatttgtctatccaagaagatgaacgattagctgaacgcatatta
agcgacgttccaatggacgattggatgcaaaaactagaatctacttttacaaatatagat
attgccttttcaggcggggagtcaacgaaacaagcaacggatcgtgctatatcgcttatc
caacacgttttaaaattaaactatactacaacactacttgttacacatggcaatttactt
acactcattttaaagtactttgatcatacaatcggctttaatgaatggcgaactttaacg
aatcctgatatgtatgaaattacaatcgatgaacaatatgccctaaaacgattatgggaa
gcatcatccaagtaa

DBGET integrated database retrieval system