KEGG   Bacillus cereus biovar anthracis CI: BACI_c52810Help
Entry
BACI_c52810       CDS       T01279                                 

Gene name
murA1
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:bal00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:bal00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4972937..4974241)
Genome map
AA seq 434 aa AA seqDB search
MEKIIVRGGKRLNGTVRVEGAKNAVLPIIAAALLASDGKNVLSEVPVLSDVYTINEVLRH
LNAEVVFENNQVTIDASKELNIEAPFEYVRKMRASVQVMGPLLARNGRARIALPGGCAIG
SRPIDQHLKGFEAMGAKVQVGNGFVEAYVEGELKGAKIYLDFPSVGATENIMSAATLAKG
TTILENAAKEPEIVDLANFLNAMGAKVRGAGTGTIRIEGVDKLYGANHSIIPDRIEAGTF
MVAAAITGGDILIENAVPEHLRSITAKMEEMGVKIIEENEGVRVIGPDKLKAVDIKTMPH
PGFPTDMQSQMMALLLQADGTSMITETVFENRFMHVEEFRRMNADIKIEGRSVIMNGPNS
LQGAEVGATDLRAAAALILAGLVSEGYTRVTELKHLDRGYVDFHKKLAALGATIERVNEK
VEEVKEQEVSDLHA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
ttggaaaagatcatcgtccgtggcggaaagcggttaaacggcacagtgcgtgttgagggc
gcaaaaaatgctgtattacctataatcgctgcagccctattagcgagtgatggaaagaat
gtactatctgaagtaccagttttgtctgatgtatacacaattaatgaggtattacgtcat
ttaaatgctgaagtcgtatttgaaaataaccaagtaacaatcgatgcttctaaagagcta
aacattgaagcaccatttgaatatgtacgtaaaatgcgtgcatctgttcaagtaatggga
ccattattagcacgtaacggtcgtgctcgtattgcacttcctggtggatgtgcaattggt
tcacgtccaattgaccaacatttaaaaggcttcgaagcaatgggagcaaaagtacaggtt
ggtaacggttttgttgaggcatacgttgagggagaactaaaaggagctaaaatttattta
gacttcccaagcgtgggcgcaacagaaaatattatgtctgcagctacattagcaaaaggg
acaacaatccttgaaaacgcagcgaaagaaccagaaatcgttgacttagctaacttctta
aatgcgatgggagcgaaagtacgcggagctggaactggaacgattcgtatcgaaggcgtt
gataaattatatggtgcaaaccactctattattcctgaccgtattgaagcgggaacattc
atggttgcagcggcaattactggtggagacatcttaattgaaaatgctgtacctgaacat
ttacgctcaattacagcgaaaatggaagaaatgggtgttaaaattatcgaagaaaatgaa
ggtgtacgtgttatcggcccagataagttaaaagcggttgatattaaaactatgcctcac
ccaggtttcccaacagacatgcaatcacaaatgatggcattattactacaagctgatggc
acaagtatgattacagaaacggtatttgaaaaccgctttatgcacgttgaagaattccgt
cgtatgaatgctgatattaaaatcgaaggtcgttctgttattatgaacggtccaaacagc
ttacaaggtgctgaagtaggcgcaactgatttacgtgctgctgctgcattaatcttagct
ggtttagtatcagaaggttacactcgtgtaactgagttaaagcatcttgaccgtggttat
gtagatttccataagaaattagctgcattaggtgcaactattgaacgtgtaaacgaaaaa
gtagaagaagtgaaagaacaagaagtttctgatcttcacgcttaa

DBGET integrated database retrieval system