KEGG   Bacillus cereus biovar anthracis CI: BACI_c53640Help
Entry
BACI_c53640       CDS       T01279                                 

Gene name
speB
Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
bal  Bacillus cereus biovar anthracis CI
Pathway
Arginine and proline metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:bal00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5061249..5062121)
Genome map
AA seq 290 aa AA seqDB search
MRFDEAYSGKVFIKSHPSFEESEVVIYGMPMDWTVSYRPGSRFGPARIREVSIGLEEYSP
YLDRELEEVKYFDAGDIPLPFGNAQRSLDMIEEYVSKLLDAGKFPLGLGGEHLVSWPIFK
AMAKKYPDLAIIHMDAHTDLRESYEGEPLSHSTPIRKVCDLIDPENVYSFGIRSGMKEEF
EWAKEVGMNLYKFDVLEPLKEVLPKLEGRPVYVTIDIDVLDPAHAPGTGTLEAGGITSKE
LLDSIVAIANSNINVVGADLVEVAPVYDHSDQTPVAASKFVREMLLGWVK
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atgcgttttgatgaagcttattcaggtaaagtatttattaaaagtcatccaagttttgaa
gagtcagaggtagttatttacgggatgcctatggattggacagtaagttaccgtccagga
tctcgctttggccctgcacgtattcgtgaagtatcaatcggtcttgaagaatatagtccg
tatttagatcgtgaactagaagaggtaaaatattttgatgcgggtgatatcccattacca
ttcggaaatgcacaacgcagcttagacatgattgaagaatatgtatcaaaacttttagat
gccggtaagtttccactaggtctcggcggtgagcacctagtgtcttggccaatttttaag
gcaatggcaaaaaaatatccggatttagcaatcatccatatggatgctcatactgattta
cgtgaatcgtatgaaggggagcctttatcccactctacccctattcgtaaagtgtgtgat
ttaattgatccggaaaacgtatattctttcggaattcgttctggaatgaaggaagaattt
gaatgggcgaaagaagtaggtatgaacttatacaaatttgacgtattagaaccgttaaaa
gaagtattaccgaaacttgagggacgcccagtctatgtcacaatcgacattgatgtatta
gacccagctcacgctccaggaacaggaacgttagaagctggtggtatcacatctaaagaa
ttattagattccatcgtagcaattgcaaattcaaatataaatgtagttggagcagactta
gtagaagtagctcctgtctacgaccatagtgatcaaacaccagtcgcagcaagcaaattc
gtgcgggaaatgctgctcggttgggtaaagtaa

DBGET integrated database retrieval system