KEGG   Burkholderia ambifaria AMMD: Bamb_0174Help
Entry
Bamb_0174         CDS       T00398                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:bam02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:bam02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:206913..207995
Genome map
AA seq 360 aa AA seqDB search
MQKIKVLCVDDSALIRSLMTEIINSQPDMTVCATAPDPLVARDLIKQHNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTERGSEITLRALELGAVDFVTKPRVGIRDGMLDYA
EKLADKIRAASRARVRQTPQPQAAAPTASGQPAAPMINNPLVSTEKLIIIGASTGGTEAI
REVLTPLPPDAPAVLIAQHMPPGFTKSFAQRLNGLCRIAVKEAEHGERVLPGHAYIAPGH
AHLLLARSGANYIAQLSDEPPVNRHRPSVDVLFRSAAQHAGKNAIGVILTGMGRDGAAGL
LDMKRAGAHTFAQDEASCIVFGMPREAIALGGADEVVSLAEMSRRVMARLATMGDRVQRV
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
gtgcagaagatcaaagtgttgtgcgtcgacgattcggcgctgatccgcagcctgatgacg
gagatcatcaacagccagcccgacatgacggtgtgcgcgaccgcgcccgatccgctcgtc
gcgcgcgatctcatcaagcagcacaacccggacgtcctgacgctggacgtcgaaatgccg
cgcatggacgggctcgacttcctcgagaagctgatgcgtctgcggccgatgccggtcgtg
atggtgtcgtcgctgaccgagcgcggctccgagatcacgctgcgcgcgctcgaactcggc
gcggtggatttcgtcacgaagccgcgcgtcgggattcgcgacggcatgctcgactacgcg
gaaaagctcgcggacaagatccgcgcggcgtcgcgcgcccgcgtgcgccagacgccgcag
ccgcaggccgccgcgcccacggcgagcggccagccggccgcgccgatgatcaacaacccg
ctcgtcagtaccgagaagctgatcatcatcggtgcgtcgacgggcggcaccgaggcgatc
cgcgaggtgctgacgccgctgccgccggatgcgccggcggtgctgatcgcgcagcacatg
ccgcccggcttcaccaagtcgttcgcgcagcggctgaacggcctgtgccggatcgcggtg
aaggaagccgagcacggcgaacgcgtgctgccgggccatgcgtacatcgcgccgggccac
gcgcacctgctgctcgcgcgcagcggcgcgaactacatcgcgcagttgtccgacgagccg
ccggtgaaccgtcaccggccgtcggtcgacgtgctgttccgctcggcggcgcagcacgcg
ggcaagaacgcgatcggcgtgatcctcacggggatgggccgcgacggcgcggccggcctg
ctggacatgaagcgcgcgggcgcgcacacgttcgcgcaggacgaggcgagctgcatcgtg
ttcgggatgccgcgcgaggcgatcgcgctcggcggggcggacgaggtcgtctcgctggcc
gagatgagccggcgcgtgatggcgcgcctggcgacgatgggcgatagggtgcagcgcgtc
tga

DBGET integrated database retrieval system