KEGG   Burkholderia ambifaria AMMD: Bamb_0213Help
Entry
Bamb_0213         CDS       T00398                                 

Definition
arginase/agmatinase/formiminoglutamase
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bamb_0213
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Bamb_0213
Enzymes [BR:bam01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Bamb_0213
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:248056..249144
Genome map
AA seq 362 aa AA seqDB search
MTEPTASSDLQAEHSSTGVVRPIELIAAPSSLGLKPNGAGREPDTWRGPDALLATGLAAR
LGARVAWLPHPAYAFEPQPGTRIRNGVSIRAFSRELAAHVAGALARGAFPIVLGGDCSIL
LGCLLGNRHAGGRGLVHVDGHSDFFHPGNYDTATRLGSAAGMDLALATGRGEPLLTCWPD
LDGPLVDDRDVCQVGERDAETAEFEAAYGDIVRTAITQTTIQQLLARGPAAVAGELVDWL
HRRALRRVWLHVDLDVLDQSQLPAVDSPGSPGLDFDGLDALLGLLVASGRVAGIDFTIYD
PGLNSELAHADGSRAASRGARPRCRGRGADSAGRRMEDARPPTRTRAYLRRPKLGRFRLA
AR
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgacggagccgaccgcttcatccgacctgcaggccgaacattcgtcaaccggcgtcgtt
cggccgatcgaactcatcgccgcgccgagcagcctcggcctgaagccgaacggcgccggc
cgcgagcccgacacgtggcgcggcccggacgcgctactcgccaccggactcgccgcgcgt
ctgggcgcgcgcgttgcgtggctcccgcatcctgcctatgcgttcgagccgcaacccggc
actcgcatccgtaacggcgtgtcgatccgcgcgttctcgcgggaactcgccgcgcacgtc
gccggtgcgctcgcacggggcgcctttccgatcgtgctcggcggcgactgcagcatcctg
ctcgggtgcctgctgggcaaccggcacgcagggggccgcgggctcgtccacgtcgacggg
cacagcgacttcttccatccgggcaattacgacacggcgacgcggctcggctccgcggcc
gggatggatctcgcgctggcgaccggccggggcgagccgctgctgacgtgctggccggac
ctcgatggtccgctcgtcgacgatcgcgacgtatgccaggtcggcgagcgcgacgcggaa
accgccgagttcgaggcggcctacggcgatatcgttcgaacggcgatcacacaaacgacg
atccagcagttgctcgcgcgcgggcctgccgccgtcgctggcgaactcgtcgactggctg
cacaggcgcgcgcttcggcgggtgtggttgcacgtcgatctcgacgtgctcgatcagtcg
caacttcctgccgtggattcgcccggctcgccggggctggacttcgatgggctcgatgcg
ttgctcggcctgctcgtcgcgtccggtcgcgttgcggggatcgacttcacgatctacgat
ccggggctcaattcggagctggcgcatgcggacggatcgcgcgcagcatcgcgcggagcg
cggccgcgctgccgggggcgcggcgccgatagtgcgggccgccggatggaagacgcccgg
ccgccgacgcgaacgcgtgcctatttgcgacgcccgaaactcggccgcttccgactcgcc
gcgcgctga

DBGET integrated database retrieval system