KEGG   Burkholderia ambifaria AMMD: Bamb_0431Help
Entry
Bamb_0431         CDS       T00398                                 

Definition
protein-disulfide isomerase-like protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
bam  Burkholderia ambifaria AMMD
Brite
Enzymes [BR:bam01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Bamb_0431
Secretion system [BR:bam02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Bamb_0431
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:482599..483327
Genome map
AA seq 242 aa AA seqDB search
MKKTIRIASLALAVTMATLGCTAQADQTTDKLKATLQARLGSDAPIKSVSKSPVAGLYEV
NLGTQIIYSDAAGDYVLLGDLVDTKTHKNLTDARLSDLNKIDFASLPLANAIKVVKGNGA
RKIAVFSDPNCPYCKRLETTLQSVDNVTVYTFLYPVLSPDSTTKSKAIWCATDRAKSWEG
WMLDHRAPSGAGNCDTSALDKNLALGRGMNVTGTPTIFLPDGRRLPGAVSADQLNQALAS
SK
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaacgatccgcatcgcgtcgctggcgctggccgtcacgatggcgacgcttggc
tgcaccgcgcaggccgaccagaccaccgacaagttgaaagccacgctgcaagcgcgtctg
ggcagcgacgcgccgatcaagagcgtgtcgaaatcgccggtcgcgggcctgtatgaagtc
aacctcggcacgcagatcatctatagcgatgcagccggcgactacgtgctgctcggcgac
ctcgtcgacaccaagacgcacaagaatctgaccgacgcgcgcctgtccgacctgaacaag
atcgacttcgcgagcctgccgctcgcgaacgcgatcaaggtcgtcaagggcaacggcgca
cgcaagatcgcggtgttctccgatccgaactgcccgtactgcaagcggctcgagacgacg
cttcagtcggtcgacaacgtgaccgtctacacgttcctgtacccggtgctgtcgcccgat
tcgaccacgaagtcgaaggcgatctggtgcgcgaccgaccgcgcgaaaagctgggagggc
tggatgctcgaccatcgcgcaccgtccggcgccggcaactgcgatacgagcgcgctcgac
aagaacctcgcgctcggccgcgggatgaacgtcacgggcacgccgacgatcttcctgccc
gacggccgtcgcctgccgggcgcggtgtcggccgatcagctgaaccaggcgctcgcgtcg
agcaagtaa

DBGET integrated database retrieval system