KEGG   Burkholderia ambifaria AMMD: Bamb_0436Help
Entry
Bamb_0436         CDS       T00398                                 

Gene name
trpC
Definition
Indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:bam01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:bam00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(487646..488431)
Genome map
AA seq 261 aa AA seqDB search
MSDILDRIIAVKREEIAAAMRSAPLEALKLEASARDLRDFVGALRAKQAAGHAAVIAEVK
KASPSKGVLREHFVPADIARSYAAHGAACLSVLTDEQFFQGSVRYLEEARAACTLPVLRK
DFIVDAYQILEARAMGADAILLIAAALDTPLMQDLEAYAHSLGLAVLVEVHDRDEMEQAL
TLKTPLLGINNRNLRTFETSIQTTLDMLDMIPPERIVVTESGILSRTDVDTMRAANVNAF
LVGEAFMRADQPGEELARMFF
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacattctcgaccgaatcatcgccgtcaagcgcgaagaaatcgcggcggccatg
cgcagcgcgccgctcgaggcactgaagctggaagcatcggcgcgtgacctgcgcgacttc
gtcggcgcactgcgcgcgaagcaggcggccggccacgcggcggtgatcgccgaagtgaag
aaggcgagcccgtcgaagggcgtgctgcgcgagcatttcgtgccggccgacatcgcgcgc
tcgtatgcggcacatggcgccgcgtgcctgtcggtgctgaccgacgagcagttcttccag
ggcagcgtccgctacctcgaggaagcgcgcgcggcctgcacgctgccggtgctgcgcaag
gacttcatcgtcgacgcgtaccagatcctcgaagcacgcgcgatgggcgccgacgcgatc
ctgctgatcgcggccgcgctcgacacgccgctgatgcaggatctcgaggcgtatgcgcac
tcgctcggcctcgcggtgctggtcgaagtccacgaccgcgacgagatggaacaggcgctg
acgctgaagacaccgctgctcggcatcaacaaccgcaacctgcgcacgttcgagacgtcg
atccagaccacgctcgacatgctcgacatgattccgccggaacgcatcgtcgtgaccgag
tctgggatcctgtcgcgcaccgacgtcgacacgatgcgcgcggcgaacgtgaacgcgttc
ctcgtcggcgaagcgttcatgcgcgccgaccagccgggcgaggaactcgcgcggatgttc
ttctga

DBGET integrated database retrieval system