KEGG   Burkholderia ambifaria AMMD: Bamb_0449Help
Entry
Bamb_0449         CDS       T00398                                 

Definition
(RefSeq) enoyl-CoA hydratase (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Bamb_0449
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bamb_0449
   00650 Butanoate metabolism
    Bamb_0449
  Lipid metabolism
   00071 Fatty acid degradation
    Bamb_0449
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bamb_0449
   00310 Lysine degradation
    Bamb_0449
   00360 Phenylalanine metabolism
    Bamb_0449
   00380 Tryptophan metabolism
    Bamb_0449
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bamb_0449
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bamb_0449
   00281 Geraniol degradation
    Bamb_0449
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bamb_0449
   00627 Aminobenzoate degradation
    Bamb_0449
   00930 Caprolactam degradation
    Bamb_0449
Enzymes [BR:bam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Bamb_0449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:501166..501942
Genome map
AA seq 258 aa AA seqDB search
MSYENILVETRGRVGLVTLNRPKALNALNDALMDELGAALKAFDADDEIGAIVVTGSEKA
FAAGADIGMMATYSYMDVYRGDYITRNWETVREIRKPIIAAVAGFALGGGCELAMMCDII
FAADTAKFGQPEIKLGVMPGAGGTQRLPRAVSKAKAMDMCLTARFMDAAEAERAGLVSRV
LPADKLLDEAIAAATTIAEFSLPAVMMVKESVNRAYETTLAEGVHFERRLFHSLFATEDQ
KEGMAAFVEKRKPVFKNR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgtcttacgagaacatcctggtggagacccgggggcgtgtcgggctggtcacgctcaac
cgcccgaaggcgctcaatgcgctgaacgatgcgttgatggatgagttgggcgctgcgctg
aaagcgttcgacgcggacgacgagatcggcgcgatcgtcgtgacggggagcgagaaggcg
ttcgcggccggggccgacatcggcatgatggcgacctattcctatatggatgtgtaccgc
ggcgactacatcacgcgtaactgggagacggtccgcgagatccgcaagccgatcattgct
gccgtggcggggttcgcgctcggcggcggctgcgagctcgcgatgatgtgcgacatcatc
ttcgcggcggatacagccaagttcggccagcccgaaatcaagctgggcgtgatgccgggt
gcgggcggcacgcagcgcctgccgcgcgcggtgtcgaaggcgaaggcgatggacatgtgc
ctgaccgcgcgcttcatggatgcggccgaggctgagcgggccgggctcgtttcgcgcgtg
ctgccggccgacaagttgctcgacgaagcgattgccgcggcgacgacgatcgccgagttt
tcgctgccggcggtcatgatggtcaaggagtcggtgaaccgtgcgtatgagacgacgctg
gccgagggcgttcatttcgagcgtcggctgttccattcgctgttcgcgaccgaagatcag
aaggaagggatggcggcattcgtcgagaagcggaagccggtattcaagaaccgctga

DBGET integrated database retrieval system