KEGG   Burkholderia ambifaria AMMD: Bamb_0458Help
Entry
Bamb_0458         CDS       T00398                                 

Gene name
murE
Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Bamb_0458 (murE)
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Bamb_0458 (murE)
Enzymes [BR:bam01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Bamb_0458 (murE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:518372..519910
Genome map
AA seq 512 aa AA seqDB search
MSAARSSHPAHQQIAAALAWLRQHVAPAAQLHADTRSLRAGDVFLGYAVDGADNRAFIAD
AVARGAAAVLYQPEGLAAAPAVPVALAVPALDQLAGEIASGWYGDPSDSMLAIGVTGTNG
KTSCTQWIAAALTALHQPCAVIGTLGSGMHGHLVPTGFTTPDAPQLQRSLAQLHDAGAKA
VAMEVSSHALHQGRVNGTAFDIAVFTNLTQDHLDYHGTFDAYEAAKAKLFAWRGLRAAVV
NRDDAAGRRLLEKLAGRVRTIAYGIGDAQAPDADRELVALDVRATATGTAFHLRSSWGDA
DVEVGTLGAFNVSNLLAVLGSLLAADVPFDAAVAEIARLESVNGRMQRLGGRLQNDEPLV
VIDYAHTPDALEKTLDALRPIAAARGGRLVCMFGCGGDRDATKRPLMGVIAERLADEVVV
TSDNPRSEDPQRIIDQVIAGMTAPDHARRIEDRASAILQAVRGAAREDVVVLAGKGHEAT
QEIMGKKRAFSDQDHARLALAARATHVKGGAE
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccgctcgcagttcccatccggcgcatcagcagatcgcagccgcgcttgcgtgg
ctgcgccagcatgtggcccccgcggcgcaactgcatgccgacacgcgcagcctgcgggcc
ggcgacgtgtttctcggctatgcggtcgacggggcagacaatcgcgccttcattgccgat
gccgtcgcgcgtggcgcggccgccgtgctgtatcagccggaaggcctcgcggccgcaccg
gccgtgcccgtcgcactcgcggtgccggcgctcgaccaactggccggcgagatcgccagc
ggctggtacggcgacccgagcgacagcatgctcgcaatcggcgtgaccggcaccaacggc
aagacgtcgtgcacgcaatggatcgccgccgcgctgacggcgctgcaccagccgtgcgcg
gtgatcggcacgctcggcagcggcatgcacgggcatctggtgccgaccggcttcacgacg
ccggacgcgccgcagctgcagcgcagcctcgcgcagttgcacgacgcgggcgcgaaggcc
gtcgcgatggaagtgtcgtcgcacgcgttgcatcagggccgcgtgaacggcacggcattc
gacatcgccgtgttcacgaacctcacccaggatcacctcgactatcacggcacgttcgac
gcgtacgaagccgcgaaggcgaagctgttcgcgtggcgcggcctgcgcgcggcggtcgtc
aatcgcgacgacgcagccggccgccgcctgctcgagaagctggccggccgcgtgcgcacg
atcgcatacggaatcggcgacgcgcaggcgcccgacgccgatcgcgagctggtcgcgctc
gacgtgcgcgccaccgccacgggcacggcattccacctgcgttcgtcgtggggcgacgct
gacgtcgaggtcggtacgctcggcgcgttcaacgtcagcaatctgctcgcggtgctcggc
tcgctgctcgcggccgacgtgccgttcgacgcggcggtcgcggagatcgcacggctcgag
tccgtcaatggccgcatgcagcgcctgggcggccggctgcagaacgacgaaccgctggtc
gtgatcgactatgcgcatacgcccgatgcgctcgagaagacgctcgacgcgttgcgcccg
atcgcggccgcacgcggcggtcggctcgtgtgcatgttcggctgcggcggcgatcgcgat
gcgacgaagcgcccgctgatgggcgtgatcgccgagcggctcgccgatgaagtcgtcgtc
acgagcgacaacccgcgcagcgaagatccgcagcgaatcatcgaccaggtcatcgcgggc
atgacggcgcccgatcacgcgcgccgcatcgaggatcgcgcaagcgcgatcctgcaggcc
gtgcgtggcgccgcccgcgaggatgtcgtcgtgctggccggcaagggtcacgaggcgacg
caggaaatcatgggcaagaagcgcgcgttctccgatcaggatcacgcacggctcgcgctc
gcggcacgcgcgacgcacgtcaagggaggcgctgaatga

DBGET integrated database retrieval system