KEGG   Burkholderia ambifaria AMMD: Bamb_0533Help
Entry
Bamb_0533         CDS       T00398                                 

Definition
guanine-specific ribonuclease N1 and T1
Orthology
K01167  
ribonuclease T1 [EC:3.1.27.3]
Organism
bam  Burkholderia ambifaria AMMD
Brite
Enzymes [BR:bam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.27  Endoribonucleases producing 3'-phosphomonoesters
    3.1.27.3  ribonuclease T1
     Bamb_0533
Messenger RNA biogenesis [BR:bam03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Ribonucreases
     Bamb_0533
Transfer RNA biogenesis [BR:bam03016]
 Eukaryotic Type
  3'processing and CCA adding factors
   3'processing factor
    Bamb_0533
 Prokaryotic Type
    Bamb_0533
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:599614..600045
Genome map
AA seq 143 aa AA seqDB search
MARKWLRNGALASVFAMFAMGIVGTPTGSLVSAAYARQAVSADLAVGGVDTIPTARLPRE
AVTTLGLIGTGGPYPYEKDGVVFGNRERILPKAKRGYYHEYTVPTPRARNRGARRIVCGG
PLRRIDNCYYTDDHYNSFKRIVE
NT seq 432 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcaagtggctccgcaacggcgcgctggcgtccgtcttcgcgatgttcgcgatg
ggtatcgtcggtacaccgacgggcagtctggtttccgccgcttacgcacggcaggccgtt
tcggccgacctggccgtcggcggggtcgatacgatcccgaccgcccgtctgccgcgcgag
gccgtgaccacgcttggcctgatcggcaccggtggcccctatccgtacgagaaagacggc
gtcgtcttcggcaaccgcgagcggatcctgcctaaggcgaagcgcggctactaccacgag
tacacggtgccgacgccgcgcgcacgcaatcgcggcgcgcgccgcatcgtctgtggcggg
ccgttgcgccggatcgacaactgttattacacggacgaccactacaacagttttaaacgt
attgttgaatga

DBGET integrated database retrieval system