KEGG   Burkholderia ambifaria AMMD: Bamb_0711Help
Entry
Bamb_0711         CDS       T00398                                 

Definition
FAD-binding molybdopterin dehydrogenase
Orthology
K13481  
xanthine dehydrogenase small subunit [EC:1.17.1.4]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Purine metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:bam00230]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:790489..792051
Genome map
AA seq 520 aa AA seqDB search
MSEPIRFYHRHAVREVSGADVTRTVLQYLREDAHCTGTKEGCAEGDCGACTVVVGELTDA
GTVAFKAVNACIQFLPTLDGRALLTVEDLRQPDGSLHPVQQAMVDCHGSQCGFCTPGFVM
SMWALYEKHGHEGCGSACAKAKDVPTRTEIADALTGNLCRCTGYRPIVDAAVQMFNATGE
GASQPVAPVDTAALARTLASLKRDDTFDYTTSDGARFAAPRTLDALAALKIERPDARILA
GSTDIGLWVTKQLRRLDDLIYVGQIAELQTIAHGDDWIEIGAGVTLENAYAALAGTYPEL
TEMWKRFASLPIRNAGTMGGNVANGSPIGDSMPGLIALGARVVLRGGDTVRELPLEALYT
GYQQKDMAPHEFVVSLKVPTRTGARAKLQFRTYKVSKRFDSDISAVCAAFAFIADGDTIR
EPRIAFGGMAATPKRATHTEAVLDGAQWHEATAQAAMQALERDYQPLSDMRATSTYRLDA
AKNLAYRFWLETRPHDPLPPQAVNVREVAAEAGADADARV
NT seq 1563 nt NT seq  +upstreamnt  +downstreamnt
atgagtgagccgatccgcttctaccatcgtcacgcggtccgcgaagtcagcggcgcggac
gtcacccgcaccgtgctgcagtacctgcgcgaggatgcgcactgcaccggcacgaaggaa
ggctgcgcggaaggcgactgcggcgcgtgcacggtcgtcgtcggcgagctgaccgacgcg
ggcacggtcgcgttcaaggccgtcaacgcctgcatccagttcctgccgacgctcgacggc
cgcgcgctgctgacggttgaagacctgcgccagccggacggttcgctgcacccggtgcag
caggcgatggtcgattgccacgggtcgcaatgcgggttctgcacgcccggcttcgtgatg
tcgatgtgggcgttgtatgagaagcacggccacgagggttgcggcagcgcgtgcgcgaag
gcgaaggacgtgccgacgcgcaccgagatcgccgatgcgttgacgggcaacctgtgccgc
tgcaccggctatcgcccgatcgtcgacgcggccgtccagatgttcaatgcgaccggcgaa
ggtgcgtcgcagccggtagccccggtcgacacggccgcgcttgcccgcacgctcgcgtcg
ctcaagcgtgacgacacgttcgactacacgacgagcgacggcgcgcgcttcgcggcgccg
cgcacgctcgacgcactggccgcgctgaagatcgagcggcccgacgcgcgcattctcgcg
ggcagcaccgacatcggcctgtgggtcaccaagcagttgcgccggctcgacgatctgatc
tacgtcggccagatcgccgaactgcagaccatcgcgcacggcgacgactggatcgagatc
ggcgcgggcgtgacgctcgagaacgcgtatgcggcactcgccggcacgtatccggagctg
accgagatgtggaagcgcttcgcgtcgctgccgatccgcaacgcggggacgatgggcggc
aacgtcgcgaacggctcgccgatcggcgactcgatgccgggcctgatcgcgctcggtgcg
cgcgtcgtgctgcgcggcggcgacacggtgcgcgagctgccgctcgaggcgctctacacc
ggctatcagcagaaggacatggcgccgcacgaattcgtcgtcagcctgaaggtgccgact
cgcaccggcgcgcgcgcgaagctgcagttccgcacctacaaggtgtcgaaacggttcgac
tccgacatctcggctgtgtgcgcggcgttcgcgttcatcgcggacggcgacacgatccgc
gagccgcgcatcgcgttcggcgggatggccgcgacgccgaagcgcgcgacgcacacggaa
gccgtgctcgacggcgcgcagtggcacgaagccaccgcgcaggccgcgatgcaggcgctc
gagcgcgactatcagccgctctctgacatgcgcgcgacgagcacgtatcgcctcgatgcc
gcaaagaacctggcgtatcgattctggctggagacgcgcccgcacgacccgctgccgccg
caagccgtgaatgtgcgcgaagtggccgccgaagccggcgccgacgccgacgcgcgcgtc
tga

DBGET integrated database retrieval system