KEGG   Burkholderia ambifaria AMMD: Bamb_0772Help
Entry
Bamb_0772         CDS       T00398                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bamb_0772
   00030 Pentose phosphate pathway
    Bamb_0772
   00051 Fructose and mannose metabolism
    Bamb_0772
   00052 Galactose metabolism
    Bamb_0772
   00500 Starch and sucrose metabolism
    Bamb_0772
   00520 Amino sugar and nucleotide sugar metabolism
    Bamb_0772
  Nucleotide metabolism
   00230 Purine metabolism
    Bamb_0772
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bamb_0772
Enzymes [BR:bam01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Bamb_0772
    5.4.2.8  phosphomannomutase
     Bamb_0772
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:860551..862014
Genome map
AA seq 487 aa AA seqDB search
MYDAGHARKAARLFSMHATERESMISQSIFKAYDIRGVVGKTLDADTARGIGRAFGSEVR
AQGGDAVVVARDGRLSGPELVGALADGLRAAGVDVVDVGMVPTPVGYFAASVPLALKGGE
RRVDSCIVVTGSHNPPDYNGFKMVLRGAAIYGEQIQALYRRIVDERFETGSGTFEEFDVA
DQYIARIVGDVKLARPLKLVVDAGNGVAGPLATRLFKALGCELVERFTDIDGTFPNHHPD
PAHPENLQDVIQALKDTDAELGFAFDGDGDRLGVVTKDGQIIYPDRQLMLFAEEVLSRNP
GAQIIYDVKCTRHLAQWVKAKGGEPLMWKTGHSLVKAKLRETGAPLAGEMSGHVFFKDRW
YGFDDGLYTGARLLEILAKTADPSALLNGLPDAMSTPELQLWLDEGENFRLIDKLQKEAK
FDGAEEVVTIDGLRVEYPDGFGLARSSNTTPVVVMRFESETKEGLKRIQEDFRRVLTAAK
PDVKLPF
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atgtatgatgccgggcacgcgcgaaaggcggccagattattttccatgcacgcaaccgag
agagaatcgatgatctcccaatccatcttcaaggcatatgacattcgcggtgtggtcggc
aagacgctcgacgccgacacggcgcgcgggatcggccgggcattcggcagcgaagtgcgc
gcccagggcggcgacgcggtcgtcgtcgcgcgcgacggccgcctatcggggcccgagctc
gtcggcgcactcgccgatggcctgcgtgcggccggtgtcgacgtcgtcgacgtcggcatg
gtgcccacgccggtcggctatttcgcggcgagcgtgccgcttgcactgaagggcggcgaa
cgccgcgtcgattcgtgcatcgtcgtcacgggcagccacaatccgcccgactacaacggc
ttcaagatggtgctgcgcggcgccgcgatctacggcgagcagatccaggcgctgtaccgc
cgcatcgtcgacgagcgtttcgaaacgggcagcggcacgttcgaggagttcgacgtcgcg
gatcagtacatcgcgcgcatcgtcggcgacgtgaagctcgcgcgcccgctgaagctcgtc
gtcgatgccggcaacggcgtcgcgggcccgctcgcgacgcgcctgttcaaggcgctcggc
tgcgaactcgtcgagcgcttcaccgacatcgacggcacgttcccgaaccaccaccccgat
cccgcgcacccggaaaacctgcaggacgtgatccaggcgctgaaggacaccgacgccgaa
ctcggcttcgcgttcgacggcgacggcgaccgcctgggcgtcgtcacgaaggacggccag
atcatctacccggaccgccagctgatgctgttcgcggaggaagtgctgtcgcgcaatccg
ggcgcgcagatcatctacgacgtgaagtgcacgcgccatctcgcgcagtgggtgaaggcg
aagggcggcgagccgctgatgtggaagacgggccattcgctcgtgaaggcgaagctgcgc
gagacgggtgcgccgctcgccggcgagatgagcggccacgtgttcttcaaggaccgctgg
tacggcttcgacgacggcctctacacgggcgcgcgcctgctggagatcctcgcgaagacg
gccgatccgagcgcgctgctgaacggcttgccggacgcgatgagcacgcccgagctgcag
ctctggctcgacgaaggcgagaacttccgcctgatcgacaagctgcagaaagaggcgaag
ttcgacggtgccgaggaagtcgtgacgatcgacggcctgcgcgtcgagtacccggacggt
ttcggcctcgcgcgttcgtcgaacacgacgccggtcgtcgtgatgcggttcgaatcggag
accaaggaagggctcaagcgcattcaggaggacttccgccgcgtgctgacggccgcgaag
ccggacgtcaagctgccgttctga

DBGET integrated database retrieval system