KEGG   Burkholderia ambifaria AMMD: Bamb_0825Help
Entry
Bamb_0825         CDS       T00398                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00010  Glycolysis / Gluconeogenesis
bam00052  Galactose metabolism
bam00500  Starch and sucrose metabolism
bam00520  Amino sugar and nucleotide sugar metabolism
bam00521  Streptomycin biosynthesis
bam01100  Metabolic pathways
bam01110  Biosynthesis of secondary metabolites
bam01120  Microbial metabolism in diverse environments
bam01130  Biosynthesis of antibiotics
bam01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bamb_0825
   00052 Galactose metabolism
    Bamb_0825
   00500 Starch and sucrose metabolism
    Bamb_0825
   00520 Amino sugar and nucleotide sugar metabolism
    Bamb_0825
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Bamb_0825
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Bamb_0825
Enzymes [BR:bam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Bamb_0825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase HTH_6 SIS SIS_2 HTH_IclR LacI
Motif
Other DBs
NCBI-ProteinID: ABI86384
UniProt: Q0BHI9
Position
1:complement(909567..911495)
Genome map
AA seq 642 aa AA seqDB search
MSTGAQSKAVVAVQHADGPRLLADVGGTNARFALETGPGEITQIRVYPGADYPTITDAIR
KYLKDVKISRVNHAAIAIANPVDGDQVTMTNHDWSFSIEATRRALGFDTLLVVNDFTALA
MALPGLTDAQRVQIGGGTRRQNSVIGLLGPGTGLGVSGLIPADDRWIALGSEGGHASFAP
QDEREDLVLQYARKKFPHVSFERVCAGPGMEIIYRALAARDKKRLAANVDTVEIVERAHA
GEALALEAVECFCGILGAFAGSVALTLGALGGVYIGGGVALKLGELFTRSSFRARFEAKG
RFTHYLQNIPTYLITAEYPAFLGVSAILAEQLSNRSGGASSAVFERIRQMRDALTPAERR
VADLALNHPRSIINDPIVDIARKADVSQPTVIRFCRSLGCQGLSDFKLKLATGLTGTIPM
SHSQVHLGDTATDFGAKVLDNTVSAILQLREHLNFEHVENAIEILNGARRIEFYGLGNSN
IVAQDAHYKFFRFGIPTIAYGDLYMQAASAALLGKGDVIVAVSKSGRAPELLRVLEVAMQ
AGAKVIAITSSNTPLAKRATVALETDHIEMRESQLSMISRILHLLMIDVLAVGVAIRRAS
TNGELPEAVAQARARASDDETADVLDWLSHGASPAAKDVARD
NT seq 1929 nt NT seq  +upstreamnt  +downstreamnt
atgtctactggtgcgcaaagtaaggctgtcgtcgcggtccagcatgccgacggcccgcgc
ctgctcgcggacgtcggcggcaccaacgcgcgtttcgcgctggaaaccggcccgggcgag
atcacgcagatccgcgtctatcccggcgccgactatccgacgatcaccgacgcgatccgc
aagtatctgaaggacgtgaagatcagccgcgtgaaccacgcggcgatcgcgatcgcgaac
ccggtcgacggcgaccaggtcacgatgaccaatcacgactggagcttctcgatcgaggcg
acgcgccgcgcgctcggcttcgacacgctgctcgtcgtcaacgacttcaccgcgctcgcg
atggcgctgcccggcctcaccgatgcgcagcgcgtgcagatcggcggcggcacgcgccgc
cagaacagcgtgatcgggctgctcgggcccggcaccgggctcggcgtgtccggcctgatt
ccggccgacgatcgctggatcgcgctcggcagcgaaggcggccatgcatcgttcgcgccg
caggacgagcgcgaggatctggtgctgcagtacgcgcgcaagaagtttccgcacgtgtcg
ttcgaacgcgtgtgcgcgggccccggcatggagatcatctatcgtgcgctcgccgcgcgc
gacaagaagcgcctcgccgcgaacgtcgacacggtcgagatcgtcgagcgcgcgcatgca
ggcgaagcgctcgcgctcgaggcggtcgaatgcttctgcgggattctcggcgcgttcgcg
ggcagcgtcgcgctgacgctcggcgcgctcggcggcgtctatatcggcggcggcgtcgcg
ctgaagctcggcgaactgttcacgcgctcgtcgttccgcgcgcgcttcgaggcgaagggc
cgtttcacgcactatctgcagaacatcccgacctacctgatcaccgccgaatatccggcg
ttcctcggcgtatcggcgattctcgcggagcagttgtcgaaccgttcgggcggcgcgtcg
tcggcggtgttcgagcggatccgccagatgcgcgacgcgctgacgccggcggagcgccgc
gtcgccgatctcgcgctgaaccatccgcgctcgatcatcaacgatccgatcgtcgacatc
gcgcgcaaggcggacgtgagccagccgacggtgatccgcttctgccgctcgctcggctgc
cagggcttgtcggacttcaagctgaagctcgcgaccggcctcaccggcacgattccgatg
agccatagccaggtgcatctcggcgacacggccaccgacttcggcgcgaaggtgctcgac
aacacggtgtccgcgatcctgcaactgcgcgaacacctgaacttcgagcacgtcgagaat
gcgatcgagatcctgaacggcgcgcgccgcatcgagttctacgggctcggcaattcgaac
atcgtcgcgcaggacgcgcactacaagttcttccgcttcgggattccgacgatcgcgtac
ggcgacctgtacatgcaggccgcgtcggccgcgctgctcggcaagggcgacgtgatcgtc
gcggtgtcgaagtcggggcgcgcgcccgagctgctgcgcgtgctcgaggtcgcgatgcag
gccggtgcgaaggtgatcgcgatcacgtcgagcaacacgccgctcgcgaagcgcgcgacc
gtcgcgctcgagaccgaccacatcgagatgcgcgagtcgcagctgtcgatgatctcgcgg
atcctgcatctgctgatgatcgacgtcctcgcggtcggcgtcgcgatccgtcgcgcgtcg
accaacggcgaattgccggaggccgtcgcgcaggcgcgcgcacgggcgagcgacgacgaa
acggccgacgtgctcgactggctgagccacggcgcatcgccggcggcgaaggacgtggcg
cgcgactga

DBGET integrated database retrieval system