KEGG   Burkholderia ambifaria AMMD: Bamb_0958Help
Entry
Bamb_0958         CDS       T00398                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Bamb_0958
   00670 One carbon pool by folate
    Bamb_0958
Enzymes [BR:bam01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Bamb_0958
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1048080..1048667)
Genome map
AA seq 195 aa AA seqDB search
MCRRIRAKPARAAVPVESAPFRFSSSPTFMTTLTLIVARARNGIIGRDNQLPWKLPEDLA
FFKRTTMGAPIVMGRKTHESIGRPLPGRRNIVVTRDAARRFDGCDTVTSLADALALAARD
GAAEAFLIGGAQLYAEGLALADKLIVTEIDADFDGDASFPAPDPAHWHEVSREPHQATAP
NTFGYAFVVYARKRD
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtgccggcgcatccgcgcgaagccggcgcgcgccgccgttccggtagaatcggcgcca
ttccggttctcctcttccccgaccttcatgacgacgttgaccctgatcgtcgcgcgtgcc
cgcaacggcatcatcggccgcgacaaccagttgccctggaaacttcctgaagacctcgca
ttcttcaagcgcacgacgatgggcgcgccgatcgtgatgggccgcaagacccacgagtcg
atcggccggccgctgccgggccgccgcaacattgtcgtcacgcgcgacgcagcgcgccgc
ttcgacggctgcgacaccgtcacgtcgctcgccgacgcgctcgcgctcgccgcgcgggac
ggagccgccgaagcattcctgatcggcggtgcgcagctctatgcggaaggcctcgcgctc
gccgacaagctgatcgtcaccgagatcgacgcggacttcgacggcgatgcgtcgttcccg
gcgcccgatcccgcgcactggcacgaagtgtcgcgcgaaccgcatcaggccaccgcgccg
aacacgttcggctatgcgttcgtcgtctacgcgcgcaagcgcgactga

DBGET integrated database retrieval system