KEGG   Burkholderia ambifaria AMMD: Bamb_1015Help
Entry
Bamb_1015         CDS       T00398                                 

Definition
beta-hexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bamb_1015
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Bamb_1015
Enzymes [BR:bam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Bamb_1015
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1103139..1104167
Genome map
AA seq 342 aa AA seqDB search
MKTTPGPVMLDVVGTALSRDDARRLAHPNTGGVILFARHFQNRAQLTALTDSIRAVREDI
LIAVDHEGGRVQRFRTDGFTVLPAMRRLGELWDRDVLLATKVATAVGYILAAELRACGID
MSFTPVLDLDYGHSKVIGDRAFHRDPRVVTLLAKSLNHGLSLAGMANCGKHFPGHGFAEA
DSHVALPTDDRPLDAILEQDVAPYDWLGLSLSAVIPAHVIYTQVDKRPAGFSRVWLQDIL
RGQLGFTGAIFSDDLSMEAAREGGTLTQAADAALAAGCDMVLVCNQPEAAEVVLNGLKAR
ASAESVRRLKRMRARGKSLKWDKLIVQPEYLQAQALLSSALA
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacgactcccggcccggtcatgctcgacgtcgtcggcacggccctgtcgcgcgac
gatgcgcggcgccttgcccatccgaacaccggcggcgtgatcctgttcgcgcggcatttc
cagaaccgcgcgcagctgaccgcgctgaccgattcgatccgcgcggtgcgcgaggacatc
ctgatcgccgtcgatcacgagggtggccgcgtgcagcggttccgcaccgacggcttcacg
gtgctgcccgcgatgcgccgcctcggcgaactgtgggaccgcgacgtgctgctcgcgacg
aaggtcgccaccgcggtgggttacatcctggccgccgaactgcgcgcgtgcgggatcgac
atgagcttcacgccggtgctcgacctcgactacgggcactcgaaggtgatcggcgatcgc
gcgttccatcgcgacccgcgcgtcgtcacgctgctcgcgaagagcctgaaccacgggctg
tcgctcgcgggcatggcgaactgcggcaagcatttcccggggcacggcttcgcggaagcc
gattcgcacgtcgcgctgccgaccgacgaccggccgctcgatgcgatcctcgagcaggac
gtcgcgccgtacgactggctcgggttgtcgctgtccgccgtgattcccgcgcacgtgatc
tacacgcaggtcgacaagcggccggccggcttctcgcgcgtgtggctgcaggacatcctg
cgcgggcagttgggcttcaccggcgcgatcttcagcgacgacctgtcgatggaggccgca
cgcgaaggcggcacgctcacgcaggcggccgacgcggcgctcgctgccggctgcgacatg
gtgctcgtctgcaaccagccggaggcggccgaggtcgtgctgaacgggctgaaggcgcgg
gcgtcggccgagtcggtgcgacgcctgaagcggatgcgcgcgcgcggcaagtcgctcaag
tgggacaagctgatcgtgcagcccgagtatctgcaggcgcaggcgctgttgagtagcgca
ctggcgtaa

DBGET integrated database retrieval system