KEGG   Burkholderia ambifaria AMMD: Bamb_1175Help
Entry
Bamb_1175         CDS       T00398                                 

Definition
dihydropteroate synthase (EC:2.5.1.15)
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:bam00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1285652..1286593
Genome map
AA seq 313 aa AA seqDB search
MWLHTGPFCIHQRLPPVSDSAVSAFIPAPLQCGRFSLTFERPLVMGILNATPDSFSDGGR
FLARDDALRQAERMIAEGVDLIDIGGESTRPGAPPVPLDEELARVIPLVEALRPLNVPLS
IDTYKPAVMRAALAAGADLINDIWGFRQPGAIDAVREGNSGLCAMHMLGEPQTMQVGEPD
YGDVVTDVHDFLAARAQALRDAGIAPERICVDPGFGFGKAVVDDNYALLAALRDTAPARP
DGRAYPILAGMSRKSMLGAVIGGKPPMERVAASVAAALCAVGRGAAIVRVHDVAATVDAL
KVWNAVREAARQR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
gtgtggcttcacaccggcccgttttgcattcatcaacgcctcccgcccgtgtccgattcc
gctgtttccgcgttcatccccgcgccgctccagtgcggccgcttctcgctgacgttcgaa
cgcccgctcgtgatgggcatcctcaacgcaacccccgattcgttttccgacggcggccgc
ttcctcgcgcgcgacgatgcattgcgccaggccgagcggatgatcgccgaaggcgtcgac
ctgatcgacatcggcggtgagtcgacgcgtcccggcgcgccgcccgtgccgctcgacgag
gagctcgcgcgcgtgatcccgctcgtcgaagcgctgcggccgctgaacgtgccgctgtcg
atcgacacctacaagccggccgtgatgcgcgcggcgcttgcggccggcgccgacctgatc
aacgacatctgggggttccgccagcccggggcgatcgacgcggtgcgcgagggtaacagc
gggctgtgcgcgatgcacatgctcggcgagccgcagacgatgcaggtcggcgagcccgac
tacggcgacgtcgtgaccgacgttcacgactttctcgccgcgcgtgcgcaggcgctgcgc
gacgcgggcattgcgccggagcggatctgcgtcgatccgggctttggcttcggcaaggcg
gtggtcgacgacaactacgcgctgctggccgccttgcgggacacggcgcccgcgcggccc
gacgggcgcgcgtatccgattctcgcgggcatgtcgcgcaagtcgatgctcggcgcggtg
atcggcggcaagccgccgatggaacgcgtcgcggcaagcgtggcggccgcgttgtgcgca
gtcgggcgcggcgccgcgatcgtgcgcgtgcacgatgtcgcggcgacggtcgacgcgctc
aaggtctggaatgccgtgcgcgaagccgcgcggcaacgataa

DBGET integrated database retrieval system