KEGG   Burkholderia ambifaria AMMD: Bamb_1279Help
Entry
Bamb_1279         CDS       T00398                                 

Definition
di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
bam  Burkholderia ambifaria AMMD
Brite
Enzymes [BR:bam01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Bamb_1279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1400458..1401867
Genome map
AA seq 469 aa AA seqDB search
MNLLSDESMKSRQPAAGACVRAWLHLSGALALAAALATLAGCDAQPDAGASNAQAAVASQ
ASGASQQVASATIAASGPVVAANQPQTRAQVYEGVRRMTALGKQLFFDPTLSGSGKLACA
SCHSPEHAFGPPNALAVQFGGDDMKRSGFRAVPSLKYLQGVPQFTEHFHDSDDEGDESVD
AGPTGGLTWDGRVDTGAEQARIPLTSPFEMNSTPAKVARAVKAAPYADEFRAVFGVQVLD
DDAATFKAVLRALETFEQTPELFSPYSSKYDAYLAGRAPLTPAELRGLQLFNDEKKGNCA
SCHISQRALDGTPPQFSDFGLIAIAVPRNRALPVNRDPRFHDLGACGPERTDLKGRDEFC
GLFRTPSLRNVALRKTFFHNGVYHSLEDVMRFYVERDIHPEKFYPVVHGKVQVYDDLPKR
YWPNINREPPFDRKRGDAPALNAAEIKDVIAFLNTLTDGYQPAAESAAR
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaacctactttccgacgaatcgatgaagtctcgccaaccggcagccggcgcgtgtgtg
cgcgcgtggctgcatctgagcggcgcactcgcgctggccgccgcgcttgccacccttgcc
ggctgtgacgcacagccggatgccggtgcgtcgaacgcacaggccgccgtcgcctcgcag
gcatcgggtgcctcgcagcaggttgcgtccgcaacgatcgccgcgagcggcccggtcgtc
gccgcgaaccagccgcagacccgcgcgcaggtttacgaaggcgtgcgccggatgacggcg
ctcgggaagcaacttttcttcgaccctacgctgtcaggttccggcaagctcgcgtgcgcg
tcgtgtcacagccccgagcacgcgttcggtccgccgaatgcgctggccgtgcagttcggc
ggcgacgacatgaagcgctcgggctttcgcgcggtgccgtcgctcaagtatctgcagggc
gtgccgcagttcaccgagcacttccacgactccgacgacgaaggcgacgagagcgtcgat
gcgggcccgaccggtggcctcacgtgggacggccgcgtcgacacgggcgccgagcaggcg
cgcattccgctcacgtcgccgttcgagatgaacagcacgcccgcgaaggtcgcacgggcc
gtgaaggccgcgccgtatgcggacgagttccgcgcggtgttcggcgtgcaggtgctcgac
gacgacgcggcgacgttcaaggccgtgctgcgcgcgctcgagacgttcgagcagaccccc
gagctgttctcgccgtattcgagcaagtacgacgcgtacctcgccgggcgggccccgctc
acgccggccgaactgcgcgggctgcaactgttcaacgacgagaagaagggtaattgcgcg
agctgccacatcagccagcgcgcgctcgacggcacgccgccgcagttcagcgatttcggc
ctgatcgcgatcgcggtgccgcgcaaccgcgcgctgccggtcaatcgcgatccgcgcttc
cacgatctcggcgcgtgcggccccgagcgcaccgacctgaagggccgcgacgaattctgc
gggctgttccgcacgccgtcgctgcgcaacgtcgcgctgcgcaagacgttcttccacaac
ggcgtgtaccactcgctcgaggacgtgatgcgcttctacgtcgagcgcgacatccatccg
gagaagttctatccggtcgtgcacggcaaggtgcaggtgtacgacgatctgccgaagcgc
tactggccgaacatcaaccgcgagccgccgttcgatcgcaagcgcggcgacgcacctgcg
ctgaacgcggccgagatcaaggacgtgatcgcgttcctgaacacgctgaccgacggatat
caaccggcggccgagtcggctgcgcgctag

DBGET integrated database retrieval system