KEGG   Burkholderia ambifaria AMMD: Bamb_1507Help
Entry
Bamb_1507         CDS       T00398                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Bamb_1507
Enzymes [BR:bam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Bamb_1507
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1651170..1652096
Genome map
AA seq 308 aa AA seqDB search
MTARTTGAGRVTVVGSLNMDLVVRAPRLPLPGETLAGHAYAQAAGGKGGNQAVAAARLGA
QVTMIGCVGADAHGAALRAGLEAEGIDCARLATSAAASTGVALIVVDDASQNTIVIVAGG
NGEVTPETVARHEAALAATDVLICQLETPPDAVFAALSAGRRLGRTVVLNPAPAVAPLPD
GWLPLVDYLIPNEVEAAALTGLPVRDPADAEAAARMLQAGGARNVLITLGARGVLALSAD
GAARHYPAPVVQAIDTTAAGDTFIGGFAARLAAGEDVDTAIRFAQRAAALSVTRAGAQPS
IPTLAELA
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgacggcgcgcacgacgggcgccggccgcgtgacggtggtcggcagcctcaacatggat
ctcgtcgtgcgggcgccgcggctgccgctgccgggcgaaacgctcgccggccatgcctac
gcgcaggcggcgggcggcaagggcggcaaccaggccgtcgcggccgcgcgcctcggcgcg
caggtcacgatgatcggctgcgtcggcgcggacgcgcacggcgcagcgctgcgggccggc
ctcgaggccgaaggcatcgattgcgcgcggctcgcgacgagcgcggcggcgtcgaccggt
gtcgcgctgatcgtcgtcgacgacgcgagccagaacacgatcgtgatcgtcgccggcggc
aatggcgaagtcacgccggagacggtggcgcggcacgaggccgcgctggccgcgaccgac
gtgctgatctgccagctcgagacgccgccggacgccgtgttcgcggcgctgtcggctggc
cggcggctcggccgcacggtggtgctcaatccggcgcccgcggtcgcgccgctgccggac
ggctggctgccgctggtcgattacctgatcccgaacgaagtggaggcggccgcgctcacc
gggctgccggtgcgcgacccggccgacgcagaagccgcggcgcggatgctgcaggcgggc
ggcgcgcgcaacgtgctgatcacgctcggcgcgcgcggcgtgctcgcgctgtcggccgac
ggcgcggcgcgccactatccggcgcccgtcgtgcaggcgatcgacacgaccgcggccggc
gataccttcatcggcggtttcgccgcgcggctcgccgcgggggaagacgtcgataccgcg
atccgcttcgcgcaacgcgcggcggcgctgtcggtcacgcgcgcgggcgcgcagccgtcg
attcccaccctcgccgaactggcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system