KEGG   Burkholderia ambifaria AMMD: Bamb_1550Help
Entry
Bamb_1550         CDS       T00398                                 

Definition
amidohydrolase (EC:3.5.1.32)
Orthology
K01451  
hippurate hydrolase [EC:3.5.1.32]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Phenylalanine metabolism
Class
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:bam00360]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1716622..1717785
Genome map
AA seq 387 aa AA seqDB search
MTHSVIPAGLADEMIEIRHRIHAHPELGFEEFATSDLVAEQLQAWGYTVHRGLGGTGVVA
QLKVGNGTQRLGLRADMDALPIHESTGLPYQSTIPGKMHACGHDGHTAMLLAAAKHLARE
RRFSGTLNLIFQPAEEGLGGAKKMLDDGLFEQFPCDAIFAMHNMPGFPTGKFGFLAGPFM
ASSDTVIVDVQGRGGHGAVPHKAIDSVVVCAQIVIALQTIVSRNVSPLDMAIVTVGAIHA
GDAPNVIPDRAQMRLSVRALKPEVRDLLEARIKEVVHAQAAVFGATATIDYQRRYPVLVN
DARMTTFARDVAREWVGEANLIDEMVPLTGSEDFAFLLEKRPGCYLIIGNGDGEGGCMVH
NPGYDFNDAVLPTGASYWVKLAETFLV
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcacagcgtgatccccgcaggcctcgccgacgaaatgatcgagatccggcaccgc
attcatgcccaccccgaactgggcttcgaggaattcgcgacgagcgacctcgttgccgag
cagttgcaggcatggggctacacggtgcaccgcgggctgggcggcacgggcgtggtcgcg
cagctgaaggtcggcaacggcacgcagcgcctcggcctgcgcgccgacatggacgcgctg
ccgatccacgagtcgaccggcctgccgtaccagagcacgatccccggcaagatgcacgcg
tgcggtcacgatggccacacggcgatgctgctcgcggccgcgaagcatctggcgcgcgag
cggcgcttttccggcacgctgaacctgattttccagccggccgaggaagggctcggcggc
gcgaaaaagatgctcgacgacgggctgttcgagcagttcccgtgcgatgcgatcttcgcg
atgcacaacatgccgggcttccccacgggcaagttcggcttcctggcggggccgttcatg
gcgtcgtcggataccgtgatcgtcgacgtgcaggggcgcggcggccacggcgcggtgccg
cacaaggcgatcgattcggtcgtggtgtgcgcgcagatcgtcatcgcgctgcagacgatc
gtgtcgcgcaacgtgtcgccgctcgacatggcgatcgtcacggtcggcgcgatccacgcg
ggcgacgcgccgaacgtgattcccgatcgcgcccagatgcgcctgtcggtgcgcgcgctg
aagcccgaggtgcgcgacctgctcgaggcgcgcatcaaggaagtcgttcatgcgcaggcg
gccgtgttcggcgcgaccgcgacgatcgactaccagcgccgctatccggtgctcgtcaac
gatgcgcggatgaccacgttcgcacgcgacgtcgcgcgcgagtgggtgggcgaagcgaat
ctgatcgacgagatggtgccgctcaccggcagcgaggatttcgcgttcctgctcgagaag
cggccgggctgctacctgatcatcggcaacggtgacggcgagggcggctgcatggtgcac
aaccccggctacgacttcaacgacgcggtactgccgaccggcgcgtcgtactgggtcaag
ctggccgagacgtttctggtgtga

DBGET integrated database retrieval system