KEGG   Burkholderia ambifaria AMMD: Bamb_1550Help
Entry
Bamb_1550         CDS       T00398                                 

Definition
amidohydrolase (EC:3.5.1.32)
Orthology
K01451  
hippurate hydrolase [EC:3.5.1.32]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Phenylalanine metabolism
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Amino acid metabolism
   00360 Phenylalanine metabolism
    Bamb_1550
Enzymes [BR:bam01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.32  hippurate hydrolase
     Bamb_1550
Peptidases [BR:bam01002]
 Metallo Peptidases
  Family M20
   Bamb_1550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1716622..1717785
Genome map
AA seq 387 aa AA seqDB search
MTHSVIPAGLADEMIEIRHRIHAHPELGFEEFATSDLVAEQLQAWGYTVHRGLGGTGVVA
QLKVGNGTQRLGLRADMDALPIHESTGLPYQSTIPGKMHACGHDGHTAMLLAAAKHLARE
RRFSGTLNLIFQPAEEGLGGAKKMLDDGLFEQFPCDAIFAMHNMPGFPTGKFGFLAGPFM
ASSDTVIVDVQGRGGHGAVPHKAIDSVVVCAQIVIALQTIVSRNVSPLDMAIVTVGAIHA
GDAPNVIPDRAQMRLSVRALKPEVRDLLEARIKEVVHAQAAVFGATATIDYQRRYPVLVN
DARMTTFARDVAREWVGEANLIDEMVPLTGSEDFAFLLEKRPGCYLIIGNGDGEGGCMVH
NPGYDFNDAVLPTGASYWVKLAETFLV
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
gtgacgcacagcgtgatccccgcaggcctcgccgacgaaatgatcgagatccggcaccgc
attcatgcccaccccgaactgggcttcgaggaattcgcgacgagcgacctcgttgccgag
cagttgcaggcatggggctacacggtgcaccgcgggctgggcggcacgggcgtggtcgcg
cagctgaaggtcggcaacggcacgcagcgcctcggcctgcgcgccgacatggacgcgctg
ccgatccacgagtcgaccggcctgccgtaccagagcacgatccccggcaagatgcacgcg
tgcggtcacgatggccacacggcgatgctgctcgcggccgcgaagcatctggcgcgcgag
cggcgcttttccggcacgctgaacctgattttccagccggccgaggaagggctcggcggc
gcgaaaaagatgctcgacgacgggctgttcgagcagttcccgtgcgatgcgatcttcgcg
atgcacaacatgccgggcttccccacgggcaagttcggcttcctggcggggccgttcatg
gcgtcgtcggataccgtgatcgtcgacgtgcaggggcgcggcggccacggcgcggtgccg
cacaaggcgatcgattcggtcgtggtgtgcgcgcagatcgtcatcgcgctgcagacgatc
gtgtcgcgcaacgtgtcgccgctcgacatggcgatcgtcacggtcggcgcgatccacgcg
ggcgacgcgccgaacgtgattcccgatcgcgcccagatgcgcctgtcggtgcgcgcgctg
aagcccgaggtgcgcgacctgctcgaggcgcgcatcaaggaagtcgttcatgcgcaggcg
gccgtgttcggcgcgaccgcgacgatcgactaccagcgccgctatccggtgctcgtcaac
gatgcgcggatgaccacgttcgcacgcgacgtcgcgcgcgagtgggtgggcgaagcgaat
ctgatcgacgagatggtgccgctcaccggcagcgaggatttcgcgttcctgctcgagaag
cggccgggctgctacctgatcatcggcaacggtgacggcgagggcggctgcatggtgcac
aaccccggctacgacttcaacgacgcggtactgccgaccggcgcgtcgtactgggtcaag
ctggccgagacgtttctggtgtga

DBGET integrated database retrieval system