KEGG   Burkholderia ambifaria AMMD: Bamb_1558Help
Entry
Bamb_1558         CDS       T00398                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:bam00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:1726944..1728038
Genome map
AA seq 364 aa AA seqDB search
MTDPTTPRARAVFPFAALVAQQPLQQALLLAAIDPSLGGVLVSGPRGTAKSTAARALAEL
LPEGEFVTLPLSASDEQVTGTLDLAHALAANGVRFRPGLLARAHRGVLYVDEVNLLADGL
VDTLLDVAASGVNVVERDGVSHAHDARFVLVGTMNPEEGELRPQLLDRFGLMVELENCFD
AAQRERIVKARLAFDLDPDAFRARHASAQRELRDGIHAARARLSALDFDDAVHARVSALC
IDAAVDGLRADLVMLRAARALAALEQADAVTVSHVERVADAVLRHRRHAGAPPSSGAPPS
RGDGDRDRDRDERSPPDTRRQPDDQPGAARNDATASQGEWGYLPPEPAGLRDVKSVVPLP
LKKR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatccgacgacgccccgcgcacgcgcggtgttcccgttcgcggcactggtcgcg
cagcaaccgttgcagcaggcgctgctgctcgccgcgatcgacccgtcgctcggcggcgtg
ctcgtcagcgggccgcgcggcaccgcgaaatcgaccgccgcgcgcgcgctggcggaattg
ctgcccgaaggcgaattcgtcacgctgccgctgtcggcgagcgacgagcaggtcaccggc
acgctcgatctcgcccatgcgctcgccgccaacggcgtgcgcttccggccgggcctgctc
gcccgcgcgcatcgcggcgtgctgtacgtcgatgaggtgaacctgctcgccgacgggctc
gtcgatacgctgctcgacgtcgccgcgagcggcgtgaacgtggtcgagcgcgatggcgtg
tcgcacgcgcacgatgcgcgcttcgtgttggtcggcacgatgaatcccgaggaaggcgag
ctgcgcccgcaactgctcgaccgcttcgggctgatggtcgagctcgagaactgcttcgac
gccgcgcagcgcgaacggatcgtgaaggcgcgcctcgcgttcgatctcgatccggatgcg
tttcgtgcgcgtcacgcaagcgcgcagcgagaacttcgcgacgggattcatgcggcgcgg
gcccggctgtcggcgctcgatttcgacgatgcggttcacgcccgcgtgagcgcgctgtgc
atcgacgcggccgtcgacggcctgcgcgccgacctcgtgatgctgcgcgccgcgcgcgcg
ctcgcggcgctggagcaggccgacgcggtgacggtgtcgcatgtcgaacgcgtggccgac
gcggtgctgcggcatcggcgtcatgcgggcgcgccgccgtcgtcgggcgcgccgccatcg
cgcggcgacggcgaccgcgaccgcgaccgcgacgagcgttcgccaccggacacacgccgg
caacccgacgatcaaccgggcgcggcacgcaacgatgcgacggcatcgcaaggcgagtgg
ggctacttgccacccgaaccggccggcttgcgcgatgtgaaaagcgtggtgccgctgccg
ctaaaaaaacgctga

DBGET integrated database retrieval system