KEGG   Burkholderia ambifaria AMMD: Bamb_1763Help
Entry
Bamb_1763         CDS       T00398                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:bam03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1949164..1949760)
Genome map
AA seq 198 aa AA seqDB search
MKQPSALSALVEALRVLPGVGPKSAQRMAYHLMQHDREGAERLGRSLLFATEHLQHCEKC
NTFTEAQICEVCSDDERDPTLLCVVETPADQIMLEQTMTYRGLYFVLMGRLSPLDGIGPK
EIHFDRLVRRASDGVVKEVVLATNFTNEGEATAHYLGQTLKARGLAVTRLARGVPVGGEL
EYVDAGTIARAMLDRRTM
NT seq 597 nt NT seq  +upstreamnt  +downstreamnt
atgaaacagccgtccgccctgtccgcgctcgtcgaggcgctgcgtgtcctgcccggcgtc
gggccgaaatccgcgcagcgcatggcgtaccacctgatgcagcacgatcgggagggcgcg
gagcggctcggccggtcgctgctgttcgcgaccgagcacctgcagcactgcgagaagtgc
aacacgttcacggaagcgcagatctgcgaggtgtgcagcgacgacgagcgtgatccgacg
ctgctgtgcgtcgttgagacgccggccgaccagatcatgctcgagcagacgatgacgtac
cgcgggctgtatttcgtgctgatggggcggctgagcccgctcgacgggatcggcccgaag
gaaatccatttcgaccgcctcgtgcggcgcgcgtccgacggcgtcgtcaaggaggtcgtg
ctcgcgaccaacttcacgaacgagggcgaagccaccgcgcactacctcggccagacgctg
aaggcgcgcgggctcgcggtcacgcgcctcgcgcgcggcgtgccggtcggcggcgagctc
gaatacgtcgacgcgggcaccatcgcccgcgcgatgctcgaccgccgcacgatgtaa

DBGET integrated database retrieval system