KEGG   Burkholderia ambifaria AMMD: Bamb_1775Help
Entry
Bamb_1775         CDS       T00398                                 

Definition
(GenBank) alpha/beta hydrolase fold protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00010  Glycolysis / Gluconeogenesis
bam00020  Citrate cycle (TCA cycle)
bam00620  Pyruvate metabolism
bam01100  Metabolic pathways
bam01110  Biosynthesis of secondary metabolites
bam01120  Microbial metabolism in diverse environments
bam01130  Biosynthesis of antibiotics
bam01200  Carbon metabolism
Module
bam_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bamb_1775
   00020 Citrate cycle (TCA cycle)
    Bamb_1775
   00620 Pyruvate metabolism
    Bamb_1775
Enzymes [BR:bam01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Bamb_1775
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_6 Abhydrolase_1 Hydrolase_4 Biotin_lipoyl Thioesterase Ndr Abhydrolase_5 Esterase PGAP1 Ser_hydrolase DUF915 Abhydrolase_8 DUF900 Abhydrolase_3 DUF676 Lipase_3 DUF2974
Motif
Other DBs
NCBI-ProteinID: ABI87331
UniProt: Q0BEU2
Position
1:complement(1962898..1964013)
Genome map
AA seq 371 aa AA seqDB search
MSIHMITMPKWGLSMEQGQVNGWLKAIGERVTKGDEVLDVETDKISSGVECAFDGTLRRQ
VAQEGETLPVGALLGVVAAADASDADIDAAIAEFQRDFTPSAAADDAGGPQPEKAQIGGR
TIRFLKLGDGTGTPAVLIHGFGGDLNNWLFNHAELAAHRPVWALDLPGHGESAKAVDTGS
LDELADAVLALLDAQHIDRAHLIGHSMGGAVAMAAAERAPQRVASLTLIASAGLGADINR
GYIDGFVAGNSRNTLKPHLGALFADHALVTRQLVEDLVKYKRLEGVQAALEKIANAAFDG
AAQRRVFRDRVASLAPRTLVIWGERDEVIPAQHAQGLPDGVRAEVIAGSGHMVQMEAAAD
VNRLIVAFLGD
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattcacatgatcacgatgcccaagtgggggctgtcgatggagcaggggcaggtc
aacggctggctgaaggcaatcggcgagcgcgtgacgaagggcgacgaagtgctcgacgtc
gagaccgacaagatctcgtcgggcgtcgagtgcgcgttcgacggcacgctgcgccggcag
gtcgcgcaggaaggcgagacgctgccggtcggtgcgctgctcggcgtggtggcggcggcc
gacgcgagcgatgccgacatcgatgcggcgatcgccgaattccagcgcgatttcacgccg
agcgcggccgctgacgacgccggcggcccgcagcccgagaaggcgcagatcggcgggcgc
acgatccggttcctgaagctgggcgacggcacgggcacgcctgccgtgctgatccacggc
ttcggcggcgatctgaacaactggctgttcaaccatgcggaactcgccgcgcaccgaccc
gtgtgggcgctcgatctgcccgggcacggcgagtcggccaaggcggtcgacaccggcagc
ctcgacgaattggccgacgcggtgctcgcgctgctcgacgcgcagcatatcgaccgcgcg
cacctgatcggccattcgatgggcggcgcggtcgcgatggcggcagccgagcgtgcgccg
caacgcgtggcgtcgctgacgctaatcgcgagcgccgggctcggcgccgacatcaaccgc
ggctacatcgacggcttcgtcgccggcaacagccgcaatacgctgaagccgcacctcggt
gcgctgttcgcggatcacgcgctcgtcacgcggcaactggtcgaggatctcgtcaagtac
aagcgcctcgaaggcgtgcaggccgcgctggagaagatcgcgaacgctgcgttcgacggc
gcggcccagcggcgcgtgttccgcgatcgcgtcgcgtcgctcgcgccgcgcacgctcgtg
atctggggcgagcgcgacgaggtgattcccgcgcagcatgcgcagggcttgccggatggc
gtgcgggccgaggtgatcgcgggcagcggtcacatggtgcagatggaggcggctgccgac
gtgaaccgcctgatcgtcgcgtttctcggagactga

DBGET integrated database retrieval system