KEGG   Burkholderia ambifaria AMMD: Bamb_1791Help
Entry
Bamb_1791         CDS       T00398                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bamb_1791
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bamb_1791
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Bamb_1791
Enzymes [BR:bam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Bamb_1791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(1978585..1980036)
Genome map
AA seq 483 aa AA seqDB search
MNYISTRGAGIGERHTFSDILLGGLAKDGGLYLPAEYPKVSADELARWRALPYADLAFEI
LSKFCDDVPADDLRAITRRTYTAAVYSNTRHGENASDITPLKTLGTENGTALSLLELSNG
PTLAFKDMAMQLLGNLFEYTLAKHGDALNILGATSGDTGSAAEYAMRGKAGVRVFMLSPH
KKMSAFQTAQMFSLQDPNIFNLAVEGVFDDCQDIVKAVSNDHAFKAQQKIGTVNSINWAR
VVAQVVYYFKGYFAATQSNEERVSFTVPSGNFGNVCAGHIARMMGLPIAKLVVATNENDV
LDEFFRTGAYRVRSAENTYHTSSPSMDISKASNFERFVFDLLGRDPARVMQLFRDVEEKG
GFDLAASGDFARVAEFGFVSGRSSHTDRIATIRDVFSRYDTMIDTHTADGVKVAREHLDA
GVPMVVLETAQPIKFGETIREALDREAERPAAFDGLEALPQRFEVVKADAQQVKDFIAAH
TGA
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgaactacatctccacgcgcggcgccggcatcggcgagcgccatacgttctccgacatc
ctgctcggcggtctcgcgaaggacggcgggctgtacctgccggccgagtatccgaaggtg
tcggccgacgaactcgcgcgctggcgcgcgctgccgtacgcggatctcgcattcgagatc
ctgtcgaagttctgcgacgacgtgccggccgacgacctgcgcgcgatcacgcgccgcacg
tatacggccgccgtgtacagcaacacgcgccatggcgagaacgcgtccgacatcacgccg
ctgaagacgctcggcaccgagaacggcaccgcgctgtcgctgctcgaactgtcgaacggc
ccgacgctcgcgttcaaggacatggcgatgcagctgctcggcaacctgttcgagtacacg
ctcgcgaagcacggcgacgcgctgaacattctcggcgcgacgtcgggcgacacgggcagc
gcggccgaatacgcgatgcgcggcaaggccggcgtgcgcgtgttcatgctgtcgccgcac
aagaagatgagcgcgttccagacggcccagatgttcagcctgcaggatccgaacatcttc
aacctcgcggtcgaaggcgtgttcgacgactgccaggacatcgtgaaggccgtatcgaac
gatcacgcgttcaaggcgcagcagaagatcggcacggtcaactcgatcaactgggcgcgc
gtcgtcgcgcaggtcgtgtactacttcaagggctatttcgcggcgacgcagtccaatgaa
gagcgcgtgtcgttcacggtgccgtcgggcaacttcggcaatgtctgcgcgggccacatc
gcgcggatgatgggcctgccgatcgcgaagctcgtggtcgcgaccaacgagaacgacgtg
ctcgacgagttcttccgcaccggcgcctatcgcgtgcgcagcgcggagaacacgtatcac
acgagcagcccgagcatggacatctcgaaggcgtcgaacttcgaacgcttcgtgttcgac
ctgctcggccgcgatccggcgcgcgtgatgcagctgttccgcgacgtcgaggagaagggc
ggtttcgacctcgcggcgagcggcgatttcgcgcgcgtggccgagttcggcttcgtgtcg
ggccgcagcagccacaccgaccgcatcgcgacgatccgcgacgtgttctcgcgctacgac
acgatgatcgatacgcacacggccgacggcgtgaaggtcgcgcgcgagcatctcgacgcg
ggcgtgccgatggtcgtgctcgagacggcccagccgatcaagttcggcgagacgatccgc
gaagcgctcgatcgcgaagccgagcggccggccgcattcgacgggctcgaggcgctgccg
cagcgtttcgaggtcgtgaaggccgacgcgcaacaggtgaaggacttcatcgccgcgcat
acgggcgcgtaa

DBGET integrated database retrieval system