KEGG   Burkholderia ambifaria AMMD: Bamb_1907Help
Entry
Bamb_1907         CDS       T00398                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Bamb_1907
Enzymes [BR:bam01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Bamb_1907
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Bamb_1907
Lipid biosynthesis proteins [BR:bam01004]
 Fatty acid synthase
  Component type
   Bamb_1907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2097896..2098573
Genome map
AA seq 225 aa AA seqDB search
MDTTFHWKRRAALAALLGTLLAATVPARAATAAPTSGQGRPALVVLGDSLSAEYGLPRDT
GWVALLRQRLATERIDYSVANASISGDTTSGGRARLPAVLQRLKPSIVVVELGSNDALRG
VPLATTEQNLRDIIADARQARAKVVLVGMYVPPNYGPDYTQKFHALYTRLSKELGVPLVP
FLLAGIENKPEMFQSDQMHPTQQAQGVLLDNVWPALKPLLGKPRG
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggacacgacattccactggaagagacgcgcggcgctcgccgcgctgctgggtacgttg
ctcgcagcaaccgtgcccgcacgcgccgcaacggcggccccgacatcgggccagggccgg
cccgcgctcgtcgtgctgggcgacagcctgtcggccgaatacgggctgccgcgcgacacc
ggctgggttgcgctgctgcggcaacggctcgcgaccgagcgaatcgattatagcgtcgcg
aacgcaagcatcagcggcgacaccacgagcggcggccgcgcacggctgcccgcggtgctg
caacggctcaagccgtcgatcgtcgtcgtcgagctcgggtcgaacgacgcgctgcgcggc
gtgccgctcgcgacgaccgagcagaacctgcgtgacatcatcgccgatgcgcggcaagcg
cgtgcgaaggtcgtgctggtcggcatgtacgtgccgcccaactacgggcccgattacacg
cagaaattccatgcgctctatacgcggctgtcgaaggagctcggcgtcccgctcgtgccg
ttcctgctggccggcatcgaaaacaagccggagatgttccagtcggaccagatgcatccc
acgcagcaggcgcagggcgtcctgctcgacaacgtctggcccgcgctgaaaccgctgctc
ggtaaaccgcgcggctga

DBGET integrated database retrieval system