KEGG   Burkholderia ambifaria AMMD: Bamb_2080Help
Entry
Bamb_2080         CDS       T00398                                 

Definition
isocitrate lyase
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:bam01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:bam00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2282734..2284041
Genome map
AA seq 435 aa AA seqDB search
MSRHQQAQELQQQWETDPRWKGIKRSYTADDVVRLRGSIAVEHTLAKRGAQKLWSLMNEE
PFVNALGALTGNQAMQQVKAGLKAIYLSGWQVAGDANVAGEMYPDQSLYPANSVPLVVKR
INNTLTRADQIQWSEGKNPGDEGYVDYFAPIVADAEAGFGGVLNAFELMKAMIEAGASGV
HFEDQLASVKKCGHMGGKVLVPTREAVAKLSAARLAADVMGTPTVLVARTDAEAADLITS
DIDDNDKPFLTGERTVEGFFRTKPGIEQAISRGLAYAPYADLVWCETGKPDLEYAKKFAE
AIHKQFPGKMLSYNCSPSFNWKKNLDDATIAKFQKELGAMGYKFQFITLAGFHALNYSMF
NLAHGYARTQMSAFVELQQAEFAAADKGFTAVKHQREVGTGYFDAVTQTVEREASTTALH
GSTEDEQFFDGKKVA
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcgacaccaacaggcgcaggaactgcaacagcaatgggaaaccgatccgcgctgg
aaaggcatcaagcgcagctacaccgctgacgacgtggttcgcctgcgcggctcgatcgcc
gtcgagcacacgctggccaagcgcggcgcgcaaaagctgtggagcctcatgaacgaagag
ccgttcgtcaacgcgctcggcgcgctgaccggcaaccaggcaatgcagcaggtgaaggcc
ggtctcaaggcgatctacctgtcgggctggcaagtggccggcgacgcgaacgtcgcgggc
gaaatgtacccggaccagtcgctgtacccggcgaactcggtgccgctcgtcgtcaagcgc
atcaacaacacgctgacgcgcgccgaccagatccagtggtccgaaggcaagaacccgggc
gacgaaggttacgtcgactacttcgcgccgatcgtcgcggatgcggaagccggcttcggc
ggcgtgctgaacgcgttcgagctgatgaaggcgatgatcgaggcaggcgcatcgggcgtc
cacttcgaggaccagcttgcatcggtgaagaagtgcggccacatgggcggcaaggtgctc
gtgccgacgcgcgaggccgtcgcgaagctgtcggcggcgcgtctcgccgctgacgtgatg
ggcacgccgaccgtgctggtcgcgcgcaccgacgcggaagcagcggacctgatcacgtcc
gacatcgacgacaacgacaagccgttcctgacgggcgagcgcacggtcgaaggcttcttc
cgcacgaagccgggcatcgagcaggcgatctcgcgcggcctcgcgtatgcgccgtacgcc
gatctggtctggtgcgaaacgggcaagccggatctcgagtacgcgaagaagttcgcggaa
gcgatccacaagcagttcccgggcaagatgctgtcgtacaactgctcgccgtcgttcaac
tggaagaagaacctcgacgacgcgacgatcgcgaagttccagaaggaactgggcgcgatg
ggctacaagttccagttcatcacgctggccggcttccatgcgctgaactactcgatgttc
aacctcgcgcacggctatgcccgcacgcagatgagcgcgttcgtcgaactgcagcaggcc
gagttcgcggcggccgacaagggcttcacggccgtcaagcaccagcgcgaagtcggcacc
ggatacttcgacgcggtgacgcagacggtcgagcgcgaagcctcgacgaccgcgctgcac
ggctcgaccgaggacgaacagttcttcgacggcaagaaggtcgcgtaa

DBGET integrated database retrieval system