KEGG   Burkholderia ambifaria AMMD: Bamb_2230Help
Entry
Bamb_2230         CDS       T00398                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00010  Glycolysis / Gluconeogenesis
bam00620  Pyruvate metabolism
bam00640  Propanoate metabolism
bam00680  Methane metabolism
bam01100  Metabolic pathways
bam01110  Biosynthesis of secondary metabolites
bam01120  Microbial metabolism in diverse environments
bam01130  Biosynthesis of antibiotics
bam01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bamb_2230
   00620 Pyruvate metabolism
    Bamb_2230
   00640 Propanoate metabolism
    Bamb_2230
  Energy metabolism
   00680 Methane metabolism
    Bamb_2230
Enzymes [BR:bam01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Bamb_2230
Lipid biosynthesis proteins [BR:bam01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Bamb_2230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABI87786
UniProt: Q0BDI7
Position
1:complement(2463128..2465110)
Genome map
AA seq 660 aa AA seqDB search
MSAIESVLHETRQFAPPEALAKAATISGMPAYQALAAEAERDYEGFWARLAREGLSWHKP
FTKVLDESDAPFYKWFDDGELNASYNCLDRHVEAGNGERVAVIFEADDGTVTRVTYADLL
ARVSRFANALKKRGIAKGDRVVIYMPMSIEGIVAMQACARIGATHSVVFGGFSAKSLNER
LVDVGAVALITADEQARGGKTLPLKSIADEAIAMGGCEAVKSVIVYRRTGGKVDWHAGRD
LWMHELADAESDTCAPEWVGAEHPLFILYTSGSTGKPKGVQHSTGGYLLWAAQTMKWTFD
WKPTDVFWCTADIGWVTGHTYITYGPLACGGTQVVFEGVPTYPDAGRFWKMIGDHKVTVF
YTAPTAIRSLIKAAEADDKVHPKSYDLSSLRIIGTVGEPINPEAWMWYHKHVGQERCPIV
DTWWQTETGGHMITPLPGATPTVPGSCTLPLPGIMAAVVDETGQDVPNGQGGILVVKRPW
PAMIRTIWGDPERFKKSYYPEELGGRLYLAGDGTVRDKDTGYFTIMGRIDDVLNVSGHRL
GTMEIESALVSHELVAEAAVVGRPDDTTGEAVVAFVVLKRSRPEGEEAAALAKTLRDWVG
KQIGPIAKPKDIRFGDNLPKTRSGKIMRRLLRSLAKGEAITQDTSTLENPAILDQLAEVR
NT seq 1983 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcgattgaatcggttcttcacgaaacccgtcagtttgcgccgcccgaggcgctt
gcgaaggcggcaaccatttccggcatgccggcctatcaggcgctggccgccgaagccgag
cgcgattacgagggcttctgggcgcgtctcgcccgcgaaggcctttcgtggcacaagccg
ttcacgaaggtgctcgacgagagtgacgcgccgttctacaagtggttcgacgacggcgaa
ctcaacgcgtcgtacaactgcctcgaccgtcacgtcgaagccggcaacggcgagcgcgtc
gcggtgatcttcgaggccgacgacggcaccgtcacgcgcgtcacctatgccgatctgctc
gcacgcgtgtcgcgcttcgcgaatgcgctgaagaaacgcggaatcgcgaagggcgaccgc
gtcgtcatctacatgccgatgtcgatcgaaggcatcgtcgcgatgcaagcctgcgcacgc
attggcgcgacgcactcggtcgtgttcggcggcttctccgcgaaatcgctgaatgagcgg
ctcgtcgacgtcggcgcggtcgcgctgatcaccgccgacgagcaggcccgcggcggcaag
acgctgccgctcaagagcatcgccgatgaagcgatcgcgatgggcggctgcgaagcggtg
aagagcgtgatcgtctatcgccgcaccggcggcaaggtcgactggcacgccgggcgcgac
ctgtggatgcatgaactcgcggacgccgagtccgacacgtgcgcgccggagtgggtcggc
gccgagcatccgctgttcatcctgtatacgtccggctcgaccggcaagccgaagggcgtg
cagcacagcaccggcggctacctgctgtgggccgcgcagacgatgaagtggaccttcgac
tggaagcccaccgacgtgttctggtgcacggccgacatcggctgggtcacgggtcacacg
tacatcacgtacgggccgcttgcgtgcggcggcacgcaggtcgtgttcgagggcgtgccg
acctatccggacgccgggcgcttctggaagatgatcggcgatcacaaggtcaccgtgttc
tacaccgcgccgaccgcgatccgctcgctgatcaaggccgccgaagccgacgacaaggtc
cacccgaagagctacgacctgtcgagcctgcgcatcatcggcaccgtcggcgagccgatc
aatccggaagcgtggatgtggtaccacaagcacgtcggtcaggagcgctgcccgatcgtc
gacacgtggtggcagaccgaaaccggcggccacatgatcacgccgctgccgggcgcgacg
ccgacggtgccgggttcgtgcacgctgccgctgccgggcatcatggccgcggtggtcgac
gagaccggccaggacgtgccgaacgggcaaggcgggatcctggtcgtcaagcggccgtgg
ccggcgatgatccgcacgatctggggcgacccggagcggttcaagaaaagctattacccg
gaggaactcggcggccggctgtacctggccggcgacggcacggtgcgcgacaaggacacc
ggctacttcacgatcatgggccgcatcgacgacgtgctgaacgtgtcgggccaccggctc
ggcacgatggagatcgagtcggcgctggtctcgcatgagctggtggcggaagcggcggtg
gtcggccgtccggacgacacgacgggcgaggcggtggtcgcgttcgtggtgctgaagcgt
tcgcgcccggaaggcgaggaagcggcggcgctcgcgaagactttgcgcgactgggtcggc
aagcagatcgggccgatcgcgaagccgaaggacatccgcttcggcgacaacctgccgaag
acgcgctcggggaagatcatgcggcgcctgctgcgctcgctcgcgaagggcgaggcgatc
acgcaggacacgtccacgctcgagaacccggcgatcctcgatcagctcgccgaagtgcgc
tga

DBGET integrated database retrieval system