KEGG   Burkholderia ambifaria AMMD: Bamb_2289Help
Entry
Bamb_2289         CDS       T00398                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bamb_2289 (tpiA)
   01230 Biosynthesis of amino acids
    Bamb_2289 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bamb_2289 (tpiA)
   00051 Fructose and mannose metabolism
    Bamb_2289 (tpiA)
   00562 Inositol phosphate metabolism
    Bamb_2289 (tpiA)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Bamb_2289 (tpiA)
Enzymes [BR:bam01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bamb_2289 (tpiA)
Exosome [BR:bam04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bamb_2289 (tpiA)
  Exosomal proteins of bladder cancer cells
   Bamb_2289 (tpiA)
  Exosomal proteins of melanoma cells
   Bamb_2289 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2524667..2525422)
Genome map
AA seq 251 aa AA seqDB search
MSKQRTKRVIGNWKMHGRLAGNQALLNEVVQGAGAVAAETSIGVCVPFPYLAQVQAQLGA
GRVVFGAQDVSAHEQGAFTGEVAAAMVAEFGAHYAIVGHSERRAYHGERNETVAAKTQRA
LAAGLTPVVCVGETLDEREAGATEQVVGAQLDAVLAVLTADEAARIVVAYEPVWAIGTGK
SATSAQAQDVHAFLRARLAAKGAAHVSVLYGGSVKPDNAEELFAQPDIDGGLIGGASLKA
QDFLAICRAAR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacaacgaacaaagcgagtgatcggcaactggaagatgcacggccggctggcc
ggcaaccaggcgttgctcaatgaagtggtgcagggcgcgggcgcggtggcggctgaaacg
tcgatcggcgtgtgcgtgccgttcccgtacctcgcgcaggttcaggcgcagctcggcgct
ggccgtgtcgtgttcggcgcgcaggacgtgtccgcgcacgagcagggcgcgttcaccggc
gaagtcgctgcggcgatggtggcggagttcggtgcgcattatgcgatcgtcggtcactcg
gaacgtcgcgcgtatcacggcgagcgcaacgagaccgtcgcggcgaagacgcagcgcgcg
ctcgcggcgggcctcacgcccgtcgtgtgcgtcggcgaaacgctcgacgagcgtgaagcg
ggcgcgaccgagcaggtggtcggtgcgcagctcgacgcggtgctggccgtgctgacggct
gacgaagcagcccgcatcgtcgtcgcgtacgagccggtgtgggcaatcggcaccggcaag
agcgcgacgtcggcgcaggcgcaggatgtgcacgcgttcctgcgtgcgcgtctcgcggcg
aagggtgcggcgcacgtgtcggtgctgtacggcggcagcgtgaagccggacaacgcggaa
gagctgttcgcgcagccggacatcgacggcggcctgatcggcggcgcgtcgctgaaggcg
caagatttcctggcgatctgccgggccgcacgttga

DBGET integrated database retrieval system