KEGG   Burkholderia ambifaria AMMD: Bamb_2289Help
Entry
Bamb_2289         CDS       T00398                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00010  Glycolysis / Gluconeogenesis
bam00051  Fructose and mannose metabolism
bam00562  Inositol phosphate metabolism
bam00710  Carbon fixation in photosynthetic organisms
bam01100  Metabolic pathways
bam01110  Biosynthesis of secondary metabolites
bam01120  Microbial metabolism in diverse environments
bam01130  Biosynthesis of antibiotics
bam01200  Carbon metabolism
bam01230  Biosynthesis of amino acids
Module
bam_M00002  Glycolysis, core module involving three-carbon compounds
bam_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bamb_2289
   00051 Fructose and mannose metabolism
    Bamb_2289
   00562 Inositol phosphate metabolism
    Bamb_2289
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Bamb_2289
Enzymes [BR:bam01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Bamb_2289
Exosome [BR:bam04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Bamb_2289
  Exosomal proteins of bladder cancer cells
   Bamb_2289
  Exosomal proteins of melanoma cells
   Bamb_2289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ABI87845
UniProt: Q0BDC8
Position
1:complement(2524667..2525422)
Genome map
AA seq 251 aa AA seqDB search
MSKQRTKRVIGNWKMHGRLAGNQALLNEVVQGAGAVAAETSIGVCVPFPYLAQVQAQLGA
GRVVFGAQDVSAHEQGAFTGEVAAAMVAEFGAHYAIVGHSERRAYHGERNETVAAKTQRA
LAAGLTPVVCVGETLDEREAGATEQVVGAQLDAVLAVLTADEAARIVVAYEPVWAIGTGK
SATSAQAQDVHAFLRARLAAKGAAHVSVLYGGSVKPDNAEELFAQPDIDGGLIGGASLKA
QDFLAICRAAR
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaaacaacgaacaaagcgagtgatcggcaactggaagatgcacggccggctggcc
ggcaaccaggcgttgctcaatgaagtggtgcagggcgcgggcgcggtggcggctgaaacg
tcgatcggcgtgtgcgtgccgttcccgtacctcgcgcaggttcaggcgcagctcggcgct
ggccgtgtcgtgttcggcgcgcaggacgtgtccgcgcacgagcagggcgcgttcaccggc
gaagtcgctgcggcgatggtggcggagttcggtgcgcattatgcgatcgtcggtcactcg
gaacgtcgcgcgtatcacggcgagcgcaacgagaccgtcgcggcgaagacgcagcgcgcg
ctcgcggcgggcctcacgcccgtcgtgtgcgtcggcgaaacgctcgacgagcgtgaagcg
ggcgcgaccgagcaggtggtcggtgcgcagctcgacgcggtgctggccgtgctgacggct
gacgaagcagcccgcatcgtcgtcgcgtacgagccggtgtgggcaatcggcaccggcaag
agcgcgacgtcggcgcaggcgcaggatgtgcacgcgttcctgcgtgcgcgtctcgcggcg
aagggtgcggcgcacgtgtcggtgctgtacggcggcagcgtgaagccggacaacgcggaa
gagctgttcgcgcagccggacatcgacggcggcctgatcggcggcgcgtcgctgaaggcg
caagatttcctggcgatctgccgggccgcacgttga

DBGET integrated database retrieval system