KEGG   Burkholderia ambifaria AMMD: Bamb_2463Help
Entry
Bamb_2463         CDS       T00398                                 

Definition
(GenBank) Aldehyde dehydrogenase (NAD(+))
  KO
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Glycolysis / Gluconeogenesis
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bamb_2463
   00053 Ascorbate and aldarate metabolism
    Bamb_2463
   00620 Pyruvate metabolism
    Bamb_2463
  Lipid metabolism
   00071 Fatty acid degradation
    Bamb_2463
   00561 Glycerolipid metabolism
    Bamb_2463
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bamb_2463
   00310 Lysine degradation
    Bamb_2463
   00330 Arginine and proline metabolism
    Bamb_2463
   00340 Histidine metabolism
    Bamb_2463
   00380 Tryptophan metabolism
    Bamb_2463
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bamb_2463
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bamb_2463
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Bamb_2463
Enzymes [BR:bam01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     Bamb_2463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
1:2712150..2713589
Genome map
AA seq 479 aa AA seqDB search
MEEAKHFIAGEWTLPAQLETIPVVDPSDGQPFATIARGTAPDIERAVAAAREAFVGPWGA
ASAAERGRVLMRLSARVADHLEELATIEARDTGKPLKQARADAAALVRYFEFYAGAADKL
HGETLPYQAGYTVLTVREPHGVTGHIVPWNYPMQIFGRSVGAALAAGNACVVKPAEDACL
SVLRVAELAAEAGLPAGALNIVTGYGHEAGAALARHPGIDHISFTGSPATGKLVTQMAAE
NHVPVTLELGGKSPQIVFADADLEAALPVLVSAIVQNGGQTCSAGSRVLIEHAVYEPLVD
RLATAFNALRVGPSRADLDCGPLINAKQQQRVWDFLSDAQHDGIPMAGHGQVVADAPESG
FYQAPALLRDVPASHRLAQEEVFGPVLAAMRFVDEEEAVALANGTPYGLVAGIWTRDGAR
QLRLARRLRAGQVFINNYGAGGGVELPFGGVGHSGHGREKGFEALYGFTALKTIAIRHG
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggaagaagcgaagcacttcatcgcgggcgaatggacgttgcccgcgcagctggagaca
atcccggtcgtcgatccctccgacggccagccgttcgcgacgatcgcgcgcggcaccgcc
cccgacatcgagcgcgcggtcgccgcggcccgcgaagcgttcgtgggcccgtggggcgcg
gcgagcgccgccgagcgcggccgcgtgctgatgcggctgtcggcgcgcgtcgccgaccat
ctcgaggaactcgcgacgatcgaggcgcgcgacaccggcaagccgctgaagcaggcgcgt
gccgatgccgccgcgctcgtgcgctatttcgagttctacgcgggcgctgccgacaagctg
cacggcgagaccctcccctatcaggccggctatacggtgctgaccgtgcgcgagccgcac
ggcgtcaccggccacatcgtgccgtggaactacccgatgcagatcttcgggcgcagcgtc
ggcgcggcgctcgcggccggcaacgcgtgcgtcgtgaagccggccgaggacgcgtgcctg
tcggtgctgcgcgtcgccgagctggccgccgaagccgggctgccggccggtgcgctcaat
atcgtcaccggctatggccatgaggcgggcgccgcgctcgcgcgccacccgggcatcgac
cacatctcgttcaccggctcgcccgcgaccggcaagctcgtcacgcagatggccgccgag
aaccacgtgcccgtcacgctcgagctcggcggcaagtcgccgcagatcgtgttcgccgac
gccgatctcgaagcggcgctgcccgtgctcgtgtcggcgatcgtgcagaacggcgggcag
acctgctcggccggcagccgcgtgctgatcgagcacgcggtctacgagccgctcgtcgat
cggctcgccaccgcgttcaacgcgctgcgggtcggcccgagccgcgcggatctcgactgc
ggcccgctgatcaacgcgaagcagcagcagcgcgtgtgggatttcctgtccgacgcgcag
catgacggcattccgatggccgggcacggccaggtcgtcgccgacgcgcccgaaagcggc
ttctaccaggcccccgcgctgctgcgcgacgtgccggcgtcgcaccggctcgcgcaggag
gaagtattcggcccggtgctcgccgcgatgcgtttcgtcgacgaggaggaagcggtcgcg
ctcgcgaacggcacgccgtacggcctcgtcgcaggcatctggacccgcgacggcgcgcgc
cagctgcgcctcgcgcggcgcctgcgcgccggtcaggtgttcatcaacaactacggtgcg
ggcggcggcgtcgaactgccgttcggcggcgtcggccattcgggccatggccgcgagaaa
ggcttcgaggcgctgtatggcttcaccgcactgaagacgatcgcgatccggcacggctga

DBGET integrated database retrieval system