KEGG   Burkholderia ambifaria AMMD: Bamb_2467Help
Entry
Bamb_2467         CDS       T00398                                 

Definition
bifunctional uroporphyrinogen-III synthetase/uroporphyrin-III C-methyltransferase (EC:2.1.1.107 4.2.1.75)
Orthology
K13543  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Bamb_2467
Enzymes [BR:bam01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     Bamb_2467
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Bamb_2467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2717318..2719285)
Genome map
AA seq 655 aa AA seqDB search
MAGGARAFTAVLTRPDGQSAGLSAQLAEAGCDVLEFPLIDIAPVDDPAPLDAAFAALDRY
ALVIFVSPNAIDRALAQYDAIWPNALPVGVVGPGSVAALERHGIAAPAHRVIAPQAPADG
GVPHYDSENLFASIEAAFGGAQALAGKHVLIVRGDGGREWLAERLREAGADVTLVAAYRR
VVPEPRVGAWERVHVLLAGAPHAWLVTSSEGVRNLHELARTHLNDAEIEALKHAPLVTPH
PRIEQTARALGFDRITLTGAGDERIVRAFRTMADEAVQPATAAPVTKRMTDTNDSKSVAS
QPAAASAPPSSPPYLAQSPARRGSSAALWFVVVVLGCAAGVGAYALNRKVDRLDATFVAR
QKALDAQTAETRMKTEQALAGTHQVDTQLAQLDGKLADAQSAQQALQQQYQDLSRNRDAW
MLEEVDQMLSSASQQLQLTGNTQLALIALQNADARLATSQSAQAVTVRKALAQDIEKLKA
APSADLTGLAIKLDDAIAKIDALPLSGEAIVPHAAPKAAPADAASSVAADTPRWKVWWHD
FSAGLGEQLKGLVQVRRIDNADAMLASPDQGYFVRENVKLRLLTARLSLLSRNDTAMKAD
LHAAQASLGKYFDQASKDTQTVQDLLRQVDGASLTVAVPNLNTSLNAVQQFKSRG
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcggcgcgcgcgcgttcaccgccgtcctgacgcgtccggacggccagtcggcc
ggactctcggcccagctggccgaggccggctgcgacgtgctcgaattcccgctgatcgac
atcgcgccggtggacgatccggcgccgctcgacgccgcgttcgcggcgctcgaccgttac
gcgctggtgatcttcgtgtcgccgaacgcgatcgaccgcgcgctcgcgcagtacgacgcg
atctggccgaatgcgctgccggtcggcgtcgtcggcccgggcagcgtcgcggcgctcgag
cgccacggaatcgccgcgcccgcgcatcgcgtgatcgcgccgcaggcgcccgccgacggc
ggtgtcccgcattacgattcggaaaacctgttcgcgagcatcgaggccgcgttcggcggc
gcgcaggcgctcgccggcaagcacgtgctgatcgtgcgcggcgacggcgggcgcgaatgg
ctcgccgagcggctgcgcgaagccggcgcggacgtcacgctggtcgccgcgtaccggcgc
gtcgtgcccgagccgcgcgtcggcgcgtgggaacgcgtgcatgtgctgctcgccggcgcg
ccgcacgcgtggctcgtcacgagctccgaaggcgtgcgcaacctgcacgaactcgcgcgc
acccacctgaacgacgccgagatcgaagcgctgaagcatgcgccgctcgtgacgccgcac
ccgcgcatcgagcagaccgcccgcgcactgggttttgataggattacgctgaccggcgcg
ggcgatgagcgcatcgtccgcgcgtttcgaacgatggccgacgaggccgtccaaccggcg
acagccgcaccggtgactaaacgcatgacagataccaacgattccaaaagcgtcgcttcc
cagccggccgctgcatccgcgccgccgtccagtcccccttatctcgcgcaatcgcctgcg
cgccgcggcagcagcgcggcgctgtggttcgtcgtcgtcgtgctcggctgcgccgcgggc
gtgggcgcctacgcgctgaaccgcaaggtcgaccggctcgacgcgacgttcgtcgcgcgc
cagaaggcgctcgacgcgcaaacggccgagacgcgcatgaagaccgagcaggcgctcgcg
ggcacgcaccaggtcgatacgcagctcgcgcagctcgacggcaagctcgccgacgcgcag
agcgcgcagcaggcgctgcagcagcagtaccaggacctgtcgcgcaaccgcgacgcgtgg
atgctggaagaagtcgaccagatgctgtcgagcgcgagccagcagctgcagctcacgggc
aacacgcagctcgcgctgatcgcgctgcagaatgccgacgcgcgcctcgcgacgtcgcag
agcgcgcaggccgtcacggtgcgcaaggcgctcgcgcaggacatcgagaagctgaaggct
gccccgtcggccgacctcacgggcctcgcgatcaagctcgacgacgcgatcgcgaagatc
gacgcgctgccgctgtcgggcgaggcgatcgttccgcacgcggcgccgaaggccgcgccg
gccgatgccgcatcgtcggtcgcggccgacacgccgcgctggaaggtgtggtggcatgac
ttctcggcgggcctcggcgagcaactgaagggcctcgtgcaggtgcgccggatcgacaat
gcggacgcgatgctcgcgtcgcccgaccagggctacttcgtgcgcgagaacgtgaagctg
cgcctgctcaccgcgcggctgtcgctgctctcgcgcaacgacaccgcgatgaaggccgac
ctgcatgcggcgcaggcgtcgctcggcaagtatttcgaccaggcatcgaaggacacgcaa
accgtccaggatctgctccggcaggtcgacggcgcatcgctgacggtcgcggtgccgaac
ctgaacacgagcctgaacgccgttcagcagttcaagagccgggggtaa

DBGET integrated database retrieval system