KEGG   Burkholderia ambifaria AMMD: Bamb_2483Help
Entry
Bamb_2483         CDS       T00398                                 

Definition
OmpA/MotB domain-containing protein
Organism
bam  Burkholderia ambifaria AMMD
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:2738901..2739599
Genome map
AA seq 232 aa AA seqDB search
MFVVVVDSFNQEREESKMNMKIATRLSVFALAGALLAGCATQQGNNAAVGTGTGAALGAG
IGALAGGGKGAAIGAGVGALVGGVTGYNWQAIKNKLAPSAAQTGTQVTEQPDGSLKLNVP
SSVTFATNQYAITPAFTPLLNDLATTLNQNPQLTGSVIGYTDSTGSAQLNQTLSQNRAQS
VVNALAQRGVAGGRLSAQGMGPSNPIADNATEAGRAQNRRVEIYLRAPQQHQ
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
ttgtttgtcgtcgttgtcgactcgttcaaccaagaaagagaggaatccaagatgaacatg
aaaatcgcgacccgcttgtccgtcttcgcattggccggcgcattgctggcaggctgcgcc
acgcagcaaggcaacaacgcggccgtcggcaccggcaccggtgcggcgctgggtgcgggc
atcggcgcgctggccggtggcggcaagggcgcggcgatcggcgcaggcgtcggcgcactg
gtcggcggcgtgaccggctacaactggcaggcgatcaagaacaagctcgcaccgtcggca
gcgcagaccggcacgcaagtgaccgagcagccggacggctcgctgaagctgaacgtgccg
agctcggtgaccttcgcgacgaaccagtacgcgatcacgccggccttcacgccgctgctg
aacgacctggcgacgacgctgaaccagaacccgcaactgacgggatcggtcatcggctac
acggacagcacgggttcggcacagctgaaccagacgctgtcgcagaaccgtgcgcaaagc
gtcgtgaacgcgctggcgcagcgcggcgtcgcgggcggccgtctgtcggcccagggcatg
ggcccgtcgaacccgatcgcggacaacgcgaccgaagccggccgtgcgcaaaaccgccgc
gtcgagatctacctgcgcgcgccgcagcagcatcagtaa

DBGET integrated database retrieval system