KEGG   Burkholderia ambifaria AMMD: Bamb_2554Help
Entry
Bamb_2554         CDS       T00398                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Class
Metabolism; Overview; Fatty acid metabolism [PATH:bam01212]
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:bam01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2810298..2811494)
Genome map
AA seq 398 aa AA seqDB search
MLNSLLDFLSHGLLRFSWWQVALFALAVTHVTIIGVTVYLHRCQAHRALELHPIASHFFR
MWLWMTTGMLTGQWAAIHRKHHAKCETEEDPHSPQTRGIWKVFLEGAELYRAEAKNEETM
RKFSHGTPNDWIERNLYSKYPILGVSLMMVLDVALFGVLGLTVWAVQMVWIPFWAAGVVN
GFGHFWGYRNFNSADASTNLFPWGIVIGGEELHNNHHTFATSAKLSNKWYEFDIGWMYIR
IMSAFGLAKVKKVAPTPRLNKPKTVLDQETLQAVLSNRYEVMASYGKAVKRAYRQELAHL
KELGASDKYQLMRSARKWFHKDADGLDEPQKKLLPEIFANSQKLQTYFQLRQDLAAIWDR
STASREQLLAQLQDWCHRAEQSGIKALQEFATRLRRYA
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
ttgttgaattccctgctcgattttctttcccacgggctcctgcgtttttcgtggtggcag
gtcgcgctgttcgcgcttgccgtcacgcacgtcacgatcatcggcgtgacggtctacctg
catcgctgccaggcgcaccgcgcgctggagctgcatccgatcgcgagccatttcttccgc
atgtggctgtggatgacgaccggcatgctgacgggccagtgggccgcgatccatcgcaag
caccacgcgaagtgtgaaaccgaggaagatccgcacagcccgcagacgcgcgggatctgg
aaggtgttcctcgagggcgccgagctgtatcgcgcggaagcgaagaacgaagaaacgatg
cgcaagttcagccacggcacgccgaacgactggatcgagcgcaatctgtactcgaagtac
ccgatcctcggcgtgagcctgatgatggtgctcgacgtcgcgctgttcggcgtgctcggc
ctgaccgtatgggccgtgcagatggtctggattccgttctgggccgccggtgtcgtgaac
ggcttcggccacttctggggctaccgcaacttcaactcggccgatgcgagcacgaacctg
ttcccgtggggcatcgtgatcggcggcgaagagctgcacaacaaccaccacacgttcgcg
acgtcggcgaagctgtcgaacaagtggtacgagttcgacatcggctggatgtacatccgc
atcatgtcggcattcggtctcgcgaaggtgaagaaggtcgcaccgacgccgcgcctgaac
aagccgaagacggtgctcgaccaggaaacgctgcaggccgtgttgtcgaaccgctacgaa
gtgatggcgagctacggcaaggccgtcaagcgtgcatatcgccaggagctcgcgcacctg
aaggagcttggtgcgagcgacaagtaccagctgatgcgcagcgcgcgcaagtggttccac
aaggacgccgacggcctcgacgagccgcagaagaagctgctgccggaaatcttcgcgaac
agccagaagctgcagacgtacttccagctgcgccaggatctggccgcgatctgggatcgc
tcgaccgcgtcgcgcgaacagctgctcgcgcaattgcaggattggtgccatcgcgcagaa
caaagcggcatcaaggcgctgcaggaattcgcgacacgtctgcgtcgctacgcctga

DBGET integrated database retrieval system