KEGG   Burkholderia ambifaria AMMD: Bamb_2696Help
Entry
Bamb_2696         CDS       T00398                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bamb_2696 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bamb_2696 (sucC)
   00640 Propanoate metabolism
    Bamb_2696 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Bamb_2696 (sucC)
Enzymes [BR:bam01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Bamb_2696 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(2970006..2971172)
Genome map
AA seq 388 aa AA seqDB search
MKIHEYQGKEILRKFGVAVPRGKPAFSVDEAVKVAEELGGPVWVVKAQIHAGGRGKGGGV
KVAKSIEQVREYANQILGMQLVTHQTGPEGQKVNRLMIEEGADIKQELYVSLVVDRISQK
IVLMGSSEGGMDIEEVAEKHPELIHKVIVEPSTGLLDAQADDLAAKIGVPAASIPQARAI
LQGLYKAFWETDASLAEINPLNVSGDGKVIALDAKFNFDSNALFRHPEIVAYRDLDEEDP
AEIEASKFDLAYISLDGNIGCLVNGAGLAMATMDTIKLFGGEPANFLDVGGGATTEKVTE
AFKLMLKNPDLKAILVNIFGGIMRCDVIAEGVIAGSKAVNLNVPLVVRMKGTNEDLGKKM
LADSGLPIISADSMEEAAQKVVAAAAGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaagattcacgagtaccagggtaaggaaatcctgcggaaattcggagtcgcggtaccg
cgcggcaagccggcgttctcggttgacgaggccgtcaaggtggcagaagagctcggcggc
ccggtgtgggtcgtgaaggctcagattcacgcgggtggccgtggcaagggcggcggcgtg
aaggtggcgaagtcgatcgagcaggtccgcgaatacgcgaaccagatcctcggcatgcag
ctcgtcacgcaccagacgggtccggaaggccagaaggtcaaccgtctgatgatcgaagaa
ggcgccgacatcaagcaggaactgtatgtcagcctcgtcgtggatcgcatctcgcaaaag
atcgtgctgatgggttcgagcgaaggcggcatggacatcgaagaagtcgccgaaaagcac
ccggaactgatccacaaggtcatcgtcgagccgtcgacgggcctgctcgacgcgcaggcg
gacgacctcgccgcgaagatcggcgtgccggctgcttcgatcccgcaagcgcgcgcgatc
ctgcaaggcctgtacaaggcattctgggaaaccgatgcgtcgctggctgaaatcaacccg
ctgaacgtttccggcgacggcaaggtcatcgcactcgacgcgaagttcaacttcgactcg
aacgcgctgttccgccacccggaaatcgtcgcgtaccgcgacctggacgaagaagatccg
gctgaaatcgaagcgtcgaagttcgacctcgcgtacatctcgctcgacggcaacatcggc
tgcctcgtgaacggcgcaggcctcgcgatggcgacgatggacaccatcaagctgttcggc
ggcgagccggcgaacttcctggacgtcggcggcggcgccacgaccgagaaggtcacggaa
gcgttcaagctgatgctgaagaacccggacctgaaggcgatcctcgtgaacatcttcggc
ggcatcatgcgctgcgacgtgatcgcggaaggcgtgatcgccggttcgaaggccgtgaac
ctgaacgtgccgctcgtcgtgcgcatgaagggcacgaacgaggacctcggcaagaagatg
ctggccgattcgggcctgccgatcatctcggcggacagcatggaagaggctgcgcagaag
gttgtcgcggctgccgcaggcaagtaa

DBGET integrated database retrieval system