KEGG   Burkholderia ambifaria AMMD: Bamb_2858Help
Entry
Bamb_2858         CDS       T00398                                 

Definition
formamidopyrimidine-DNA glycosylase (EC:3.2.2.23)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:bam03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:complement(3152050..3152904)
Genome map
AA seq 284 aa AA seqDB search
MNAVSDPQNMPELPEVEVTRRGIEPFVAGRRVERVDVRTAMLRWPVPAGLAEQLRAREVL
AVERRGKYLLFEVDAGWFIVHLGMTGTLRVLPAAGVPVAAKHDHIDWIFDEFVLRFRDPR
RFGAVLWHPREAGDVHAHPLLASLGVEPFSPAFTGALLHARTRGRTVSVKQALLAGDMVV
GVGNIYASESLFRAGIRPTTAAGKVSLPRYERLADAVRATLADAIERGGSTLRDFVGSNG
ESGYFQLDCFVYDRAGLPCRVCGTPIRQIVQGQRSTYFCPTCQR
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgccgtttcagacccgcaaaacatgccagagttgccagaagtcgaagtcacgcgc
cggggcatcgagccctttgtcgcgggccgccgcgtcgagcgtgtcgacgtccgtaccgcg
atgctgcgctggcccgtgccggcggggctcgcggagcaattgcgcgcgcgcgaggtgctc
gccgtcgagcgtcgcggcaagtacctgctgttcgaggtcgacgcgggctggttcatcgtg
catctcgggatgacgggcacgctgcgcgtgctgcccgcggccggcgtgccggtcgccgcg
aaacacgaccacatcgactggatcttcgacgagttcgtgctgcgctttcgcgatccgcgc
cgtttcggcgccgtgttgtggcacccgcgcgaagcgggcgacgtgcatgcgcatccgctg
ctcgcgagcctcggcgtcgagccgttctcgccggcattcaccggcgcgctgctgcacgcg
cgcacgcgcgggcgcacggtgtcggtcaagcaggcgctgctcgcgggcgacatggtggtc
ggcgtcggcaacatctatgcgtcggagagcctgtttcgcgccggcatccggccgacgacc
gccgccggcaaggtctcgctgccgcgctacgagcgactggccgatgcggtgcgcgcgacg
ctcgccgacgcgatcgagcgcggcggcagcacattgcgcgactttgtcggcagcaacggc
gaaagcggctatttccagctcgactgcttcgtctacgaccgtgcggggctgccttgccgc
gtatgcggcacgccgatccgccagatcgtgcagggccagcgctcgacctatttctgcccg
acctgccagcgttga

DBGET integrated database retrieval system