KEGG   Burkholderia ambifaria AMMD: Bamb_2880Help
Entry
Bamb_2880         CDS       T00398                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bamb_2880
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Bamb_2880
Enzymes [BR:bam01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Bamb_2880
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3173679..3176162
Genome map
AA seq 827 aa AA seqDB search
MKSTLPSLLTGLLIAALLPAATCAAPVQTAAGAIAGTARAAMQPADLAALLSNGLALRVS
VDNNHAAAAGVPCADLGADGAACATGRLFLQNRGHQPIADGGWKLYLHSIRRLLRIDHPG
FALRRLTGDLYELTPQPGSVRLAPGERIELPFVAEYWVRRYSDVIPRPYVVVDGASPAVL
RYNDTDNELRYVESLPADAQNNSTGNAPAVAARPDASRALPSVKREQPLPGALDLRGVEL
LLAGLPDAQVAALRERATTLGLDGARVPVLGAVAPRRLPADIATPGGYRLAIGPRGVLIE
GYDRAGLYYGVQTLFSLAPAGGGTIPALLIEDAPRFTHRGMHVDLARNFKQPATLRRLID
QMSAYKLNRLHLHLSDDEGWRIEIPGLPELTDIGARRCHDPSETRCLLPQLGSGPDNRSG
GGYLTRADYVALVRYAADRFIDVIPEIDMPAHARAAVVSMEARYRRLHAAGRDQDANAYR
LLDPQDTSNLTTVQFYDRRSDLNPCVPGALNFASKVIREIAAMHADAQAPLRIWHYGGDE
AKNILLGGGFQPLNGTDPNKGRIDLAAQDKPWARSPACTALLQRGEIKSIDELPTRFAKQ
VSAAVDANGIGTMAAWQDGIKHANGPQDFSTRHVMVSLWDTIFWGASDSARDLSGKGYQT
VLALPDYLYFDFPYTLNPRERGYYWGSQATDEYKVFSLAPENLPQNAEVMGDRDGNAFEV
TGTGPAPRIEGIQGQAWGEVMRNDTFLEYMVYPRLLALAERAWHRADWELPYTAGVRYKR
GDTHRVDTAALQRDWAGFATLVTQRELPKLDRAGIGYRKPTFTLMNP
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atgaagagcacgttgccctccctgctgaccggcttgctgatcgcggcgctgttgccggcc
gcgacctgcgccgcgccggtgcaaaccgccgccggcgcgatcgccggcaccgcccgggcg
gccatgcagccggccgatctcgcggcattgctgtcgaacggcctcgcgttgcgcgtgtcc
gtggacaacaaccacgcggccgcggccggcgtgccgtgtgcggacctcggcgccgacggc
gcggcctgcgcgacgggccgcctgtttctgcaaaaccgcggccaccagccgatcgccgac
ggcggctggaagctctacctgcacagcatccgccgcctgctgcgcatcgatcatccgggc
ttcgcgctgcgccggctcaccggcgacctgtacgagctgacaccgcagccgggatcggta
cggctcgcgcccggcgaacgcatcgagctgccgttcgtcgccgaatactgggtgcggcgc
tacagcgacgtgattccgcggccgtacgtcgtcgtcgacggcgcatcgcctgcggtgctc
cgctacaacgacaccgacaacgagcttcgctacgtcgaatcgctgccggccgacgcgcag
aacaactcgacgggcaacgcgccggccgtcgccgcgcggcccgacgcgagccgcgcactg
ccgagcgtgaagcgcgagcagccgctgcccggcgcgctcgatctacgcggcgtcgagctc
ttgctggccggcctgcccgacgcgcaggtcgcggcgctgcgcgagcgcgcgacgacgctc
ggtctcgacggcgcacgcgtgccggtgctcggcgcggtcgcaccgcgccggctgccggcc
gacatcgcgacgccgggcggctaccggctcgcgatcgggccgcgcggcgtcctcatcgaa
ggctacgatcgcgccggcctctactatggcgtgcagacgctgttctcgctcgcgccggcc
ggcggcggcacgatcccggcgctgctcatcgaggatgcgccgcgcttcacgcatcgcggg
atgcacgtcgatctcgcgcgcaacttcaagcagccggcgacgctgcgccgcctgatcgac
cagatgagtgcatacaagctcaatcgcctgcacctgcacctgtccgacgacgaaggctgg
cgcatcgagattcccggcctgcccgagctgaccgacatcggcgcgcgccgctgccacgac
ccgagcgagacgcgctgcctgctgccgcaactcggctccggccccgacaatcgctcgggc
ggcggctacctgacgcgcgccgactacgtcgcgctcgtgcgctatgcggccgaccgcttc
atcgacgtgattcccgaaatcgacatgcccgcgcacgcgcgcgcggccgtggtgtcgatg
gaggcgcgctaccgccggctgcatgcggccggccgcgaccaggacgcgaacgcgtatcgg
ctgctcgatccgcaggacacgtcgaacctgacgacggtgcagttctacgaccggcgcagc
gacctgaacccgtgcgtgccgggcgcgctcaacttcgcgtcgaaggtaatccgcgagatc
gcggcgatgcatgcggacgcgcaggcgccgctgcgcatctggcactacggcggcgacgaa
gcgaagaacatcctgctcggcggcggcttccagccgttgaacggcaccgatccgaacaag
gggcgcatcgacctcgccgcgcaggacaagccgtgggcgcgctcgcccgcgtgcacggcg
ctgctccagcgcggcgagatcaagtcgatcgacgagctgccgacgcgcttcgcgaaacag
gtgagcgcagcggtcgacgcgaacgggatcggcacgatggccgcgtggcaggacggcatc
aagcacgcgaacgggccgcaggacttcagcacgcggcatgtgatggtgtcgctgtgggac
acgatcttctggggcgcgtcggacagcgcgcgcgacctgagcggcaagggctaccagacg
gtgctggcgctgcccgattacctgtacttcgacttcccgtacacgctgaacccgcgcgag
cgcggctattactggggctcgcaggcaaccgacgagtacaaggtgttctcgctcgcgccg
gagaacctgccgcagaacgccgaagtgatgggcgatcgcgacggcaacgcgttcgaggtg
accggcacgggccccgcgccgcgcatcgaaggtattcaggggcaggcctggggcgaggtg
atgcgcaacgacacgttcctcgagtacatggtgtatccgcgcctgctcgcgctcgccgaa
cgcgcgtggcaccgcgccgactgggagctgccgtacacggccggcgtgcgctacaagcgc
ggcgacacgcaccgcgtcgacacggccgcgctgcagcgcgactgggccggtttcgcgacg
ctggtcacgcagcgcgaattgccgaagctcgaccgtgccggcattggctatcggaagccg
accttcacgctgatgaatccgtga

DBGET integrated database retrieval system