KEGG   Burkholderia ambifaria AMMD: Bamb_2912Help
Entry
Bamb_2912         CDS       T00398                                 

Gene name
gpmA
Definition
phosphoglyceromutase (EC:5.4.2.1)
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bamb_2912 (gpmA)
   01230 Biosynthesis of amino acids
    Bamb_2912 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Bamb_2912 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    Bamb_2912 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bamb_2912 (gpmA)
Enzymes [BR:bam01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     Bamb_2912 (gpmA)
Exosome [BR:bam04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   Bamb_2912 (gpmA)
  Exosomal proteins of melanoma cells
   Bamb_2912 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1:3209585..3210331
Genome map
AA seq 248 aa AA seqDB search
MYKLVLIRHGESTWNKENRFTGWVDVDLTEQGRNEAYQAGELLKEAGYTFDIAYTSVLKR
AIRTLWHVQDRMDLMYLPVVHSWRLNERHYGALSGLNKAETAAKFGDDQVLVWRRSYDTP
PPALEPTDERAPFNDPRYAKVPREQLPLTECLKDTVARVLPLWNESIAPAVRSGKQVLIA
AHGNSLRALIKYLDGISDSDIVGLNIPNGVPLVYELDEDLKPIQHYYLGDQDAIAKAQAA
VAKQGKAG
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaactcgttctcatccgccacggcgaatcgacgtggaacaaggaaaaccgcttc
accggctgggtcgacgtcgacctgaccgaacagggtcgcaacgaggcctaccaggccggc
gaattgctcaaggaggccggctacacgttcgacatcgcgtacacgtcggtgctcaagcgc
gcgatccgcacgctgtggcacgtgcaggaccggatggacctgatgtacctgccggtcgtc
cactcgtggcgcctgaacgagcgccactacggcgcgctgtcgggcctgaacaaggcggaa
acggccgccaagttcggcgacgaccaggtgctcgtgtggcgccgcagctacgacacgccg
ccgcccgcactcgagccgaccgacgagcgcgcgccgttcaacgacccgcgctacgcgaag
gtgccgcgcgaacagctgccgctcaccgagtgcctgaaggacacggtcgcgcgcgtgctg
ccgctgtggaacgaatcgatcgcgccggccgtccgctcgggcaagcaggtgctgatcgcc
gcgcacggcaactcgctgcgcgcgctgatcaagtacctcgacggcatttcggacagcgac
atcgtcggcctgaacatcccgaacggcgtgccgctcgtgtatgaactcgacgaagacctg
aagccgatccagcactactacctcggcgaccaggacgcgatcgcgaaggcgcaggccgcc
gtcgcgaagcagggcaaggcgggctga

DBGET integrated database retrieval system