KEGG   Burkholderia ambifaria AMMD: Bamb_3312Help
Entry
Bamb_3312         CDS       T00398                                 

Definition
succinate dehydrogenase, cytochrome b subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Bamb_3312
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bamb_3312
   00650 Butanoate metabolism
    Bamb_3312
  Energy metabolism
   00190 Oxidative phosphorylation
    Bamb_3312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:103576..103944
Genome map
AA seq 122 aa AA seqDB search
MAANNRIGSKRLVVGAHYGLRDWLAQRVTATIMAVYTVILLALFFGAHDFSYEGWASIFS
AQWMKLATFVTLLSLFYHAWVGVRDIWMDYVKPVGVRLLLQSLTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaataaccgaatcggctcgaagcgcctcgtcgtcggcgctcactacggcctg
cgcgactggctcgcgcagcgcgtcaccgccacgatcatggcagtctacacggtcattctg
ctcgcgctgttcttcggcgcgcatgacttctcgtacgaaggctgggcgtcgatcttctcc
gcgcaatggatgaagctcgcgaccttcgtgacgctgctttccctcttctaccacgcatgg
gtcggcgtgcgcgacatctggatggactacgtgaagcccgtcggtgtgcgcctgctgctg
caatcgctgaccatcgtctggctgctcgcatgtgcgggctacgccgcgcagattctctgg
agagtgtaa

DBGET integrated database retrieval system