KEGG   Burkholderia ambifaria AMMD: Bamb_3312Help
Entry
Bamb_3312         CDS       T00398                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00020  Citrate cycle (TCA cycle)
bam00190  Oxidative phosphorylation
bam00650  Butanoate metabolism
bam01100  Metabolic pathways
bam01110  Biosynthesis of secondary metabolites
bam01120  Microbial metabolism in diverse environments
bam01130  Biosynthesis of antibiotics
bam01200  Carbon metabolism
Module
bam_M00009  Citrate cycle (TCA cycle, Krebs cycle)
bam_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
bam_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Bamb_3312
   00650 Butanoate metabolism
    Bamb_3312
  Energy metabolism
   00190 Oxidative phosphorylation
    Bamb_3312
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: ABI88867
UniProt: Q0BAF6
Position
2:103576..103944
Genome map
AA seq 122 aa AA seqDB search
MAANNRIGSKRLVVGAHYGLRDWLAQRVTATIMAVYTVILLALFFGAHDFSYEGWASIFS
AQWMKLATFVTLLSLFYHAWVGVRDIWMDYVKPVGVRLLLQSLTIVWLLACAGYAAQILW
RV
NT seq 369 nt NT seq  +upstreamnt  +downstreamnt
atggcagccaataaccgaatcggctcgaagcgcctcgtcgtcggcgctcactacggcctg
cgcgactggctcgcgcagcgcgtcaccgccacgatcatggcagtctacacggtcattctg
ctcgcgctgttcttcggcgcgcatgacttctcgtacgaaggctgggcgtcgatcttctcc
gcgcaatggatgaagctcgcgaccttcgtgacgctgctttccctcttctaccacgcatgg
gtcggcgtgcgcgacatctggatggactacgtgaagcccgtcggtgtgcgcctgctgctg
caatcgctgaccatcgtctggctgctcgcatgtgcgggctacgccgcgcagattctctgg
agagtgtaa

DBGET integrated database retrieval system