KEGG   Burkholderia ambifaria AMMD: Bamb_3348Help
Entry
Bamb_3348         CDS       T00398                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00260  Glycine, serine and threonine metabolism
bam00400  Phenylalanine, tyrosine and tryptophan biosynthesis
bam01100  Metabolic pathways
bam01110  Biosynthesis of secondary metabolites
bam01130  Biosynthesis of antibiotics
bam01230  Biosynthesis of amino acids
Module
bam_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bamb_3348
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bamb_3348
Enzymes [BR:bam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bamb_3348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABI88903
UniProt: Q0BAC0
Position
2:141220..142413
Genome map
AA seq 397 aa AA seqDB search
MYNLPDDHGHFGPYGGVFVAETLIHALDELRAAYEKFRNDPDFVAEYERELKHFVGRPSP
IYHAQRWSETLGGAQIYLKREDLNHTGAHKINNVIGQALLAKRMGKKRVIAETGAGQHGV
ATATICARFGMECIVYMGAEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNIESTFYIIGTVAGPHPYPAMVRDFQRVIGDECKVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIDDTSVQLIGVEAAGDGLDTGRHAASLIAGSPGVLHGNRTYLLQDDDGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAQYVPITDEEALKAFHDCCRIEGIIPALESSHAIAY
GVKLAPTLPKDKILLVNLSGRGDKDMHTVAERSGIAL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaccttcctgatgatcacggccatttcggcccgtatggcggcgtgttcgttgcc
gaaacgctgattcacgcgctggacgaactgcgcgccgcgtatgaaaaattccggaacgac
cccgatttcgtcgccgaatacgagcgcgaactgaagcacttcgtcggccgtccgtcgccg
atctatcacgcgcagcgctggagcgagacgctcggcggcgcgcagatctacctgaagcga
gaggacctgaaccacaccggcgcgcacaagatcaacaacgtgatcggccaggcgctgctc
gcgaagcgcatgggcaagaagcgcgtgatcgccgagacgggcgccggccagcacggcgtc
gcgacggcgacgatctgcgcgcgcttcgggatggagtgcatcgtctacatgggcgccgag
gacgtgcgccgccaggccgcgaacgtctaccgcatgaagctgctcggcgcgacggtcgtg
ccggtcgaatcgggttcgcgcacgctgaaggacgcgctgaacgaagcgatgcgcgactgg
gtcacgaacatcgaaagcacgttctacatcatcggcacggtcgcgggcccgcacccgtat
ccggcgatggtgcgcgacttccagcgcgtgatcggcgacgagtgcaaggtgcagatgccg
gaactcgccggccggcagccggacgcggtgattgcgtgcgtcggcggcggctcgaacgcg
atgggcatcttctatccgtatatcgacgacacgtcggtgcagctgatcggcgtcgaagcg
gccggcgacggcctcgacaccggccgtcacgcggcgtcgctgatcgccggcagccccggc
gtgctgcacggcaaccgcacgtacctgctgcaggacgacgacggccagatcatcgagacg
cattcggtgtcggccggcctcgactatccgggtgtcggccccgagcacgcatggctgaag
gacagcggccgcgcgcaatatgtgccgatcaccgacgaagaggcgctgaaggcgttccac
gactgctgccggatcgaggggatcatccccgcgctcgagtcgagccacgcgatcgcgtat
ggcgtgaagctcgcgccgacgttgccgaaggacaagatcctgctcgtcaacctgtcgggc
cgcggcgacaaggacatgcacacggtcgccgagcgatcgggcatcgcgctctga

DBGET integrated database retrieval system