KEGG   Burkholderia ambifaria AMMD: Bamb_3348Help
Entry
Bamb_3348         CDS       T00398                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bamb_3348
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bamb_3348
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bamb_3348
Enzymes [BR:bam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bamb_3348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2:141220..142413
Genome map
AA seq 397 aa AA seqDB search
MYNLPDDHGHFGPYGGVFVAETLIHALDELRAAYEKFRNDPDFVAEYERELKHFVGRPSP
IYHAQRWSETLGGAQIYLKREDLNHTGAHKINNVIGQALLAKRMGKKRVIAETGAGQHGV
ATATICARFGMECIVYMGAEDVRRQAANVYRMKLLGATVVPVESGSRTLKDALNEAMRDW
VTNIESTFYIIGTVAGPHPYPAMVRDFQRVIGDECKVQMPELAGRQPDAVIACVGGGSNA
MGIFYPYIDDTSVQLIGVEAAGDGLDTGRHAASLIAGSPGVLHGNRTYLLQDDDGQIIET
HSVSAGLDYPGVGPEHAWLKDSGRAQYVPITDEEALKAFHDCCRIEGIIPALESSHAIAY
GVKLAPTLPKDKILLVNLSGRGDKDMHTVAERSGIAL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacaaccttcctgatgatcacggccatttcggcccgtatggcggcgtgttcgttgcc
gaaacgctgattcacgcgctggacgaactgcgcgccgcgtatgaaaaattccggaacgac
cccgatttcgtcgccgaatacgagcgcgaactgaagcacttcgtcggccgtccgtcgccg
atctatcacgcgcagcgctggagcgagacgctcggcggcgcgcagatctacctgaagcga
gaggacctgaaccacaccggcgcgcacaagatcaacaacgtgatcggccaggcgctgctc
gcgaagcgcatgggcaagaagcgcgtgatcgccgagacgggcgccggccagcacggcgtc
gcgacggcgacgatctgcgcgcgcttcgggatggagtgcatcgtctacatgggcgccgag
gacgtgcgccgccaggccgcgaacgtctaccgcatgaagctgctcggcgcgacggtcgtg
ccggtcgaatcgggttcgcgcacgctgaaggacgcgctgaacgaagcgatgcgcgactgg
gtcacgaacatcgaaagcacgttctacatcatcggcacggtcgcgggcccgcacccgtat
ccggcgatggtgcgcgacttccagcgcgtgatcggcgacgagtgcaaggtgcagatgccg
gaactcgccggccggcagccggacgcggtgattgcgtgcgtcggcggcggctcgaacgcg
atgggcatcttctatccgtatatcgacgacacgtcggtgcagctgatcggcgtcgaagcg
gccggcgacggcctcgacaccggccgtcacgcggcgtcgctgatcgccggcagccccggc
gtgctgcacggcaaccgcacgtacctgctgcaggacgacgacggccagatcatcgagacg
cattcggtgtcggccggcctcgactatccgggtgtcggccccgagcacgcatggctgaag
gacagcggccgcgcgcaatatgtgccgatcaccgacgaagaggcgctgaaggcgttccac
gactgctgccggatcgaggggatcatccccgcgctcgagtcgagccacgcgatcgcgtat
ggcgtgaagctcgcgccgacgttgccgaaggacaagatcctgctcgtcaacctgtcgggc
cgcggcgacaaggacatgcacacggtcgccgagcgatcgggcatcgcgctctga

DBGET integrated database retrieval system