KEGG   Burkholderia ambifaria AMMD: Bamb_3350Help
Entry
Bamb_3350         CDS       T00398                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Bamb_3350
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bamb_3350
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Bamb_3350
Enzymes [BR:bam01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Bamb_3350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
2:143314..144132
Genome map
AA seq 272 aa AA seqDB search
MSTRIQQTFAALAEQGRKGLIPFITAGDPDPAKTVEFMHALAEGGADVIELGVPFSDPMA
DGPVIQRSSERALARGVTLKSVLADVKCFRETNQTTPVVLMGYANPIERMGVDAFATEAQ
AAGVDGVLVVDYPPEEAGVFAEKMRAAQIDPIFLLAPTSTDERIADVGKIASGYVYYVSL
KGVTGAGNLDVSSIAGKIPAIKSRVPVPVGVGFGIRDAETARAVAEVSDAVVIGSRLVQL
LESAAPEGAAAALKTFIAELRAALDGAGKTAR
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgtccacccgtatccagcagaccttcgccgcactcgccgaacaaggccgcaagggcctg
atcccgttcatcacggccggcgaccccgatcccgcgaagacggtcgagttcatgcacgcg
ctcgccgaaggcggcgccgacgtgatcgagctcggcgtgccgttctcggacccgatggcc
gacggcccggtgatccagcgctcgtcggagcgcgcgctcgcgcgcggcgtcacgctcaag
agcgtgctcgccgacgtgaagtgcttccgcgagaccaaccagacgacccccgtcgtgctg
atgggctatgcgaacccgatcgagcggatgggcgtcgacgcgttcgccaccgaagcgcag
gcagccggcgtcgacggcgtgctcgtcgtcgactatccgcccgaggaagccggcgtgttt
gccgagaaaatgcgtgccgcgcagatcgatccgatcttcctgctcgccccgacgtcgacc
gacgagcgcatcgccgacgtgggcaagatcgcgagcggctacgtgtactacgtgtcgctc
aagggcgtgaccggcgccggaaatctggatgtttcgagcattgcgggtaaaatcccggcc
atcaagtcgcgcgtgccggttccggtgggcgtcggcttcggcatccgcgacgccgaaacg
gcgcgcgcggtggccgaagtgtcggacgccgtcgtgatcggcagccgcctggtgcagctg
ctcgagagcgccgcgccggaaggcgccgccgccgcgctgaagacattcatcgccgagctg
cgcgccgccctggacggcgccggcaagacggcgcgataa

DBGET integrated database retrieval system