KEGG   Burkholderia ambifaria AMMD: Bamb_3367Help
Entry
Bamb_3367         CDS       T00398                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Bamb_3367
   00052 Galactose metabolism
    Bamb_3367
   00500 Starch and sucrose metabolism
    Bamb_3367
   00520 Amino sugar and nucleotide sugar metabolism
    Bamb_3367
Enzymes [BR:bam01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Bamb_3367
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:164126..165013
Genome map
AA seq 295 aa AA seqDB search
MLKVTRAVFPVAGLGTRFLPATKASPKEMLPVVDKPLIQYAVEEAINAGITEMIFVTGRS
KRAIEDHFDKSYEIEAELEARGKEKLLELVRGIKPSHVNCFYVRQPEALGLGHAVLCAEK
LVHGEPFAVILADDLLHGEQPVLKQLVDVFDHYHSSVIGVETIPREDSRSYGVVEGREWE
EDIIKLSGIIEKPAPEDAPSNLGVVGRYVFMPTIFDHLRKLKPGAGGELQLTDAVQSLLA
NEQVLAYRYFGTRFDCGSKIGYLKATVELALQHPEVSREFEAYLRTCLPALAAVA
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgttgaaagtcaccagggccgtgtttcccgttgccggtctcggcacgcggttcctcccg
gcaacgaaggcgagcccgaaggaaatgctgcccgtcgtcgacaagccgctgatccagtac
gcggtcgaggaagcgatcaacgccggtatcaccgagatgatcttcgtgacggggcgcagc
aagcgcgcgatcgaggatcacttcgacaagtcctacgagatcgaggccgaactcgaggcg
cgcggcaaggaaaagctgctcgagctcgtgcgcggcatcaagccgagccacgtgaactgc
ttctacgtgcgccagccggaagcgctcggcctcggccatgcggtgctgtgcgcggaaaag
ctcgtgcacggcgagccgttcgcggtgatcctcgcggacgacctgctgcacggcgaacag
ccggtgctcaagcagctcgtcgacgtgttcgaccactatcacagctcggtgatcggggtc
gagacgatcccgcgcgaggacagccgctcgtacggcgtcgtcgaaggccgcgagtgggaa
gaggacatcatcaagctgtcgggcatcatcgagaagccggcgccggaagacgcgccgtcg
aacctcggcgtggtcggccgctacgtattcatgccgacgatcttcgatcatctgcgcaag
ctcaagccgggcgccggcggcgaactgcagctgaccgacgcggttcagtcgctgctcgcc
aacgaacaggtgctcgcgtatcgctacttcggcacgcgtttcgattgcggcagcaagatc
ggttatctcaaggcgactgtcgagctcgcgctccagcatccggaagtgagccgcgaattc
gaggcgtacctgcgtacctgcctgcccgcgctggctgctgtcgcataa

DBGET integrated database retrieval system