KEGG   Burkholderia ambifaria AMMD: Bamb_3879Help
Entry
Bamb_3879         CDS       T00398                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
bam00630  Glyoxylate and dicarboxylate metabolism
bam01100  Metabolic pathways
bam01110  Biosynthesis of secondary metabolites
bam01120  Microbial metabolism in diverse environments
bam01200  Carbon metabolism
Module
bam_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:bam00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Bamb_3879
Enzymes [BR:bam01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Bamb_3879
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ABI89433
UniProt: Q0B8U0
Position
2:complement(773431..775017)
Genome map
AA seq 528 aa AA seqDB search
MSQYQDDIKAVAGLKEKQGSAWDAINPESAARMRAQNKFKTGLDIARYTAKIMRADMAAY
DADPTKYTQSLGCWHGFIGQQKMISIKKHFNSTERRYLYLSGWMVAALRSEFGPLPDQSM
HEKTSVSALIRELYTFLRQADARELGGLFRELDAAKDAAAKAAIQEKIDNHVTHVVPIIA
DIDAGFGNAEATYLLAKQFIEAGACCIQIENQVSDEKQCGHQDGKVTVPHEDFLAKIRAI
RYAFLELGVDDGIIVARTDSLGAGLTKQIAVTNTPGDLGDQYNSFLDCEELSADQLGNGD
VVIKRDGKLLRPKRLPSNLFQFRSGTGEARCVLDCITSLQNGADLLWIETEKPHIAQIGG
MVSEIRKVIPNAKLVYNNSPSFNWTLNFRQQVYDAMQAAGKDVSAYDRAQLMSVEYDQTE
LATLADEKIRTFQADASREAGIFHHLITLPTYHTAALSTDNLAKEYFGDQGMLGYVAGVQ
RKEIRQGIACVKHQNMSGSDIGDDHKEYFSGEAALKAAGKDNTMNQFS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaatatcaagacgacatcaaggcagtggctggtttgaaggagaagcaaggcagc
gcgtgggatgccatcaatccggaatcggctgcccgcatgcgtgcccagaacaagttcaag
acgggcctggacatcgcccgctacaccgcgaagatcatgcgcgccgacatggccgcgtac
gatgcggacccgaccaagtacacgcaatcgctgggttgctggcacggcttcatcggccag
cagaagatgatctccatcaagaagcacttcaacagcaccgaacgccgttacctgtacctg
tcgggctggatggtcgccgcgctgcgttcggagttcggcccgctgccggaccagtcgatg
cacgaaaagacctcggtcagcgcgctgatccgcgagctgtacacgttcctgcgccaggcc
gacgcccgtgagctgggcggcctgttccgcgagctggatgcggccaaggatgcggctgcc
aaggccgcgatccaggaaaagatcgacaaccacgtgacgcacgtcgtgccgatcatcgcc
gacatcgacgcgggtttcggcaatgccgaagcaacgtacctgctggccaagcagttcatc
gaagcgggcgcgtgctgcatccagatcgagaaccaggtgtccgacgagaagcagtgcggc
caccaggacggcaaggtcacggtgccgcacgaggacttcctcgcgaagatccgcgcgatc
cgctacgcgttcctggaactgggcgtggacgacggcatcatcgtcgcccgtaccgactcg
ctcggcgccggcctgaccaagcagatcgccgtgaccaacacgccgggcgacctgggcgac
caatacaactccttcctcgactgcgaagagctgtcggccgatcagctcggcaacggtgac
gtcgtgatcaagcgcgacggcaagctgctgcgtccgaagcgcctgccgagcaacctgttc
cagttccgctcgggcacgggtgaagcgcgttgcgtgctggattgcatcacgtcgctgcag
aacggcgccgacctgctgtggatcgaaaccgaaaagccgcatatcgcgcagatcggcggc
atggtcagcgaaatccgcaaggtgatcccgaacgcgaagctggtgtacaacaacagcccg
tcgttcaactggacgctgaacttccgtcagcaggtgtatgacgcgatgcaggcagcgggc
aaggacgtgtcggcatacgaccgcgcgcagctgatgagcgtcgagtacgaccagaccgaa
ctggccacgctcgccgacgagaagatccgcacgttccaggccgatgcgtcgcgtgaagca
ggcatcttccaccacctgatcacgctgccgacgtaccacacggccgcgctgtcgaccgac
aacctcgcgaaggaatacttcggtgaccagggcatgctcggttacgtggccggcgtgcag
cgcaaggagatccgtcagggcatcgcgtgcgtcaagcaccagaacatgtccggctcggat
atcggcgacgaccacaaggaatacttcagcggcgaagcagcgctgaaggcagcgggcaag
gacaacacgatgaaccagttctcgtaa

DBGET integrated database retrieval system