KEGG   Burkholderia ambifaria AMMD: Bamb_4187Help
Entry
Bamb_4187         CDS       T00398                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
bam  Burkholderia ambifaria AMMD
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:bam00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:bam00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2:1106298..1107593
Genome map
AA seq 431 aa AA seqDB search
MTVPQQAFLRDAMRRLNMTREAFANRIGVSRRALDTWLLPDDSQESRGMPEIVERFVSEI
VERSAPDGGEYTQSVDKQGLSKQFLFEGKPQLISVDQFSRDSVEALFRVADVMQPIARRH
KISRVLEGAVLGNLFFEASTRTRVSFGAAFCRLGGSVCDTTGFTFSSMAKGESIYDTSRV
MAGYVDALVIRHPEKGSVAEFARATNLPVINGGDGPGEHPSQALLDLYTIQREFSRLGKI
VDGAHIALVGDLKYGRTVHSLVKLLALYRGLKFTLVSPPTLEMPAYIIEQIATNGHAIEQ
TNDLAAGLRGADVVYATRIQKERFTDESFEGYTPDFQINQALVDSVCKPDTLIMHPLPRD
SRPGANDLSVDLNRDPRLAIFRQTDNGIPVRMAIFAVLLGVENLVQHSMRDATWRPPAYL
GPEDAVFHGID
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttccccagcaagccttcctgcgcgacgcgatgcgccgcctcaacatgacccgc
gaggcgttcgcgaatcgcatcggcgtaagccgtcgcgcgctcgatacgtggctattgccc
gacgactcgcaggaatcgcgcggaatgcccgagatcgtcgagcgcttcgtatcggaaatc
gtcgaacgctcggccccggacggtggcgaatatacgcaaagcgtagacaaacaagggctc
tcgaagcaattcctgttcgaaggcaagccgcagctgatctcggtagaccagttctcgcgg
gattcggtcgaggcgctgttccgcgtggccgacgtgatgcagccgatcgcgcgccgccac
aagatttcgcgcgtgctcgaaggcgccgtgctcggcaacctgttcttcgaagccagcacg
cgcacccgcgtgtcgttcggcgcggccttctgccggctcggcggctcggtatgcgacacg
accggcttcacgttctcgtcgatggccaagggcgaatcgatctacgacacgagccgcgtg
atggccggctatgtcgatgcactcgtgatccgtcacccggagaaaggctcggttgccgaa
ttcgcccgcgcgaccaacctgccggtgatcaacggcggcgacggcccgggcgaacacccg
agccaggcgctgctggatctctatacgatccagcgcgaattctcgcgactcggcaagatc
gtcgacggcgcgcacatcgcgctcgtcggcgatctgaaatacggccgcaccgtgcactcg
ctcgtcaagctgctcgcgctgtaccgcgggctgaagttcacgctcgtatcgccgccgacg
ctcgaaatgcccgcgtacatcatcgagcagatcgcgacgaacggccacgcgatcgagcag
accaacgacctcgcggccgggctgcgcggcgcggatgtcgtctatgcgacgcggatccag
aaggagcgcttcaccgacgagtcgttcgaaggctacacgccggatttccagatcaaccag
gcactcgtcgattccgtgtgcaagcccgacacgctgatcatgcatccgctgccgcgcgac
agccggcccggcgcgaacgacctgtcggtcgacctgaaccgcgatccgcgtctcgcgatt
ttccggcagaccgacaacggcattccggtgcggatggcgatcttcgcggtgctgctcggc
gtcgagaatctcgtccagcactcgatgcgcgacgcgacatggcgcccgccggcatacctc
gggccggaggatgcggtgtttcacgggatcgattga

DBGET integrated database retrieval system